KEGG   Clostridium perfringens 13: CPE1105Help
Entry
CPE1105           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cdc6_C MerR_2 Ribosomal_L9_C
Motif
Other DBs
NCBI-ProteinID: BAB80811
UniProt: Q8XLD7
Position
1307241..1307561
Genome map
AA seq 106 aa AA seqDB search
MRACKDLGINLVPVIINEELLDEDEKLKKLLATNFGREKNDPVKQGRVYEKYEKLCGIQR
GGDRRSNQKIFGLVTQEQIAKELGYRGIPYPLHLRLWNESSTKLKI
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
gtgagggcttgtaaggacttaggaattaatttagttccagtaataatcaatgaagaatta
ttagatgaagatgaaaaattaaaaaaactattagctactaactttggaagagaaaagaat
gatcctgttaaacaagggagagtttatgaaaaatacgaaaaattatgtggaattcaaaga
ggaggagatagaagatcaaaccaaaaaatttttggtttggttacccaagaacaaattgca
aaagaattaggttacaggggtattccttaccccttacaccttcggttatggaacgagagt
tctacaaaattaaagatataa

DBGET integrated database retrieval system