KEGG   Clostridium perfringens 13: CPE1115Help
Entry
CPE1115           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2397 DASH_Dad3
Motif
Other DBs
NCBI-ProteinID: BAB80821
UniProt: Q8XLC7
Position
1312258..1312500
Genome map
AA seq 80 aa AA seqDB search
MIGFTRKERKIIKTYFNRRNNLRHLADNIEKLEDKELANILRKTLFNRYKVEFISGNEDR
LADIYTKEMLEIGVKSYCIL
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgataggatttactagaaaagaaagaaaaattataaaaacatattttaatagaagaaat
aatttaagacatttagctgataatatagaaaagttagaagataaagagttagctaatatt
ttaagaaagactttatttaatagatataaggtagagtttataagtggaaatgaagataga
ttagcagatatctatactaaagaaatgttagaaattggtgttaagtcttattgtatatta
tag

DBGET integrated database retrieval system