KEGG   Clostridium perfringens 13: CPE1121Help
Entry
CPE1121           CDS       T00074                                 

Definition
(GenBank) phage phi-C31 gp35-like protein
  KO
K06904  uncharacterized protein
Organism
cpe  Clostridium perfringens 13
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    CPE1121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S78
Motif
Other DBs
NCBI-ProteinID: BAB80827
UniProt: Q8XLC1
Position
1316640..1317242
Genome map
AA seq 200 aa AA seqDB search
MEKQQKEIRKIIASDLITRTLEDTEEKVISGYINKFNTLSQYLGFFEEVLPGAFDKTLAD
GHNIYAMYNHNSDMILGSTKSGSLKLNTDEVGLHFELKINSNISYANDLYELVSNGDIDG
CSFGFYVLDDEWTYTEDKVDLRKVKEVELIEVTITPFPAYLDSEASCRSFELHNKEVEKA
KELRDLEKEIELLEIEAELL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacaacagaaggaaattagaaaaattatcgctagtgatttaattactagaaca
ttagaagacacagaagaaaaagtaataagtggatacataaataagtttaatactcttagt
cagtatttaggattttttgaagaagtcttaccaggtgcttttgataaaactttagctgat
ggtcataatatatatgctatgtacaatcataattctgatatgattttaggttctacaaag
agtggttctctaaaattaaatacagatgaagtaggactacattttgaattaaaaataaat
tctaatatatcttatgcgaacgatctatatgaattagttagcaatggagatatagatggt
tgtagctttggattttatgtattagatgatgaatggacttatacagaagataaagtggac
ttaagaaaagttaaggaagtagagttaatagaagttactattactccattcccagcttat
ttagacagtgaagctagttgtagaagctttgaattacataataaagaagttgaaaaggct
aaagaattaagagatttagaaaaagaaattgaattattagaaattgaagcagaactacta
taa

DBGET integrated database retrieval system