KEGG   Clostridium perfringens 13: CPE1123Help
Entry
CPE1123           CDS       T00074                                 

Definition
(GenBank) phage-related hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_connect_1
Motif
Other DBs
NCBI-ProteinID: BAB80829
UniProt: Q8XLB9
Position
1318478..1318771
Genome map
AA seq 97 aa AA seqDB search
MVSLEEMKQYLRIDYPDDDELITSLIQQAQIYIDSCCGINYKLHTDKVNLANLLIKKMVS
DQYDNRGLYLDSKKNGYDRMSSTILELLSNCEGVVNE
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atggttagcttagaagagatgaaacaatatcttagaatagattatccggatgatgatgaa
ttaataacaagtctaatacaacaagctcaaatatacatagatagttgttgtggtattaat
tataaattacatacagataaagttaatctagctaatttactaattaagaaaatggtttct
gatcaatatgataacaggggattatatttagattctaaaaaaaatggttatgatagaatg
tctagcactatattagaattattatctaattgtgagggtgttgttaatgaataa

DBGET integrated database retrieval system