KEGG   Clostridium perfringens 13: CPE1126Help
Entry
CPE1126           CDS       T00074                                 

Definition
(GenBank) phage-related hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3168
Motif
Other DBs
NCBI-ProteinID: BAB80832
UniProt: Q8XLB6
Position
1319535..1319885
Genome map
AA seq 116 aa AA seqDB search
MEEELDIIALVSESLAGLNVDVIEGWYDKELNNTHITVHEYLDQEDDFEDDDASTLEHNL
QIDVWSMDSLEAYTLKKKIRKLMKKNEFKYESGQDFYEVDTGIYHKALRFTYLEEI
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagaattagatattatagcattagttagtgaatcattagctggtctaaatgta
gatgttatagaaggttggtatgataaagaacttaataatacacatataacggtacatgaa
tatttagatcaggaagatgattttgaagatgacgatgctagtacattagaacataattta
caaatagatgtttggagtatggattctttggaagcttatactcttaaaaagaaaattaga
aaattaatgaaaaaaaatgaatttaaatatgaaagcggacaagatttttatgaagtagat
acaggtatttatcacaaagctttacgctttacatatttagaagagatttaa

DBGET integrated database retrieval system