KEGG   Clostridium perfringens 13: CPE1129Help
Entry
CPE1129           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAB80835
UniProt: Q8XLB3
Position
1321015..1321350
Genome map
AA seq 111 aa AA seqDB search
MQLEVFDFFETYIFIRKYVDKIQDRIREIFVGDEVIEKSAFDEYDKEEGYLDEELEEENI
YDNYLKVIDNIIQYAIKNFNNSLEATLNMDILDLLDYIEFSINQRNEEEIE
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgcaattagaagtattcgatttttttgaaacttatatttttattagaaagtatgtagac
aaaatacaagatagaatcagagaaatttttgtaggagatgaagttatagaaaaaagtgca
tttgatgaatatgacaaagaagaaggctatttagatgaagaactagaagaagagaatatc
tatgataattacctaaaggttatagacaatataatacagtacgctattaagaactttaat
aatagcttagaagcaactttaaacatggatatattagatttattagactatatagagttt
agtataaatcagagaaatgaggaggagatagagtag

DBGET integrated database retrieval system