KEGG   Clostridium perfringens 13: CPE1138Help
Entry
CPE1138           CDS       T00074                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_2 DUF5314
Motif
Other DBs
NCBI-ProteinID: BAB80844
UniProt: Q8XLA4
Position
1332512..1333426
Genome map
AA seq 304 aa AA seqDB search
MDIKKVYLKGQEEAKGWNKPNKIIIHHPEYNGSIEGLNDIMRSMGFYMIGYNFYVRKDGT
VYEGRPVWATGANCYGHNHDSIGVCFEGNYDKETDMPQEQFNAGVELIKYLKSKYGINEV
NGHKHYYNTACPGQYFPLEKMLSCLDGQLQQEVISNTPQVTNNNIDIKANAKVINDFLYA
RDINGNKVGGYVSIGDNIEVLDVSYSKQLDRIKYPTSNGAKERYVTNATNCIEYFYQDQW
QNGSTPEPVYQDSSCSQKIGTLNPYEKATPIYRKDGVLHIVYSTDKGRNTKSGYVRYNGE
FSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggatattaagaaagtatatttaaaaggtcaagaagaagctaaaggatggaataaacca
aacaaaattataatacaccatccagaatataacggatctatagaaggactaaacgatatt
atgagaagcatgggattttatatgataggatataatttctatgtacgtaaagatggtaca
gtatatgaaggtagaccagtatgggcaacaggagctaactgttatggtcacaatcatgat
agtataggtgtatgttttgaaggcaattatgataaagaaactgatatgccacaagaacaa
tttaatgctggtgtagaacttataaaatatctaaaaagtaaatatggtattaatgaagtt
aatggacataaacactattacaatacagcttgtccaggacaatatttcccactagaaaaa
atgttaagttgcttagatggacaattacaacaagaagttatttctaacacacctcaagtt
actaataacaatatagatattaaagctaatgctaaagtcattaatgattttttatatgct
agagatattaatggtaataaagttggtggatatgttagtataggagataatatagaggta
ttagatgttagctatagtaaacaactagatagaatcaaatatccaacaagtaatggagct
aaagaaagatatgttacaaatgcaactaactgtatagaatatttttaccaagatcaatgg
caaaatggaagcactccagaaccagtataccaagatagttcttgtagtcaaaaaatagga
acgttaaacccttatgaaaaagctactcctatatacagaaaagacggtgtccttcacata
gtttattctacagataagggtagaaatacaaaatctgggtatgtaagatataatggtgaa
tttagtattttttaa

DBGET integrated database retrieval system