KEGG   Clostridium perfringens 13: CPE1139Help
Entry
CPE1139           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_deac_2
Motif
Other DBs
NCBI-ProteinID: BAB80845
UniProt: Q8XLA3
Position
complement(1334196..1334990)
Genome map
AA seq 264 aa AA seqDB search
MKKLLVALLTGLSLIGLVGCGEAPITPESINTKLDQCIEISNKDAEIQKQYDWAKENNRQ
FEGVNEFTDDELNTVEYQKFLNLSKAEISVMDNDELKKTNAIVDAVLMMATDDCKEQLII
PYSVSTRDTMIRAYTEPNIIINEMHRIVNELETYKMNVNEFIEVGVPDNWEMIGVMLPES
DQSFKEIVDTIEEYNKIYIFDDEYLQIMKELQTSFHNFAEQYPKESYPRTEDSLTLQQAR
KSFNQAYDKLMMFDIRQAEGVVAP
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattattagttgctctattaacaggattatcattaataggcttagttggatgt
ggagaagctccaataacaccagaatcaataaatactaaactagaccaatgtatagaaata
tcaaacaaagatgcggaaatacaaaaacaatatgactgggcaaaagaaaataatagacaa
ttcgaaggtgtaaatgaatttacagatgatgaattaaatacagtagaatatcaaaaattc
ttaaacttatcaaaagcagaaatatcagtaatggataatgatgaacttaagaaaactaat
gcaatagtagatgcagtattaatgatggcaactgatgattgcaaagagcaattaataata
ccttattcagtatctacaagagatacaatgataagagcttatactgaaccaaatattata
ataaatgaaatgcatagaatagttaatgaattagaaacttataagatgaatgtaaatgaa
tttatagaagttggagttcctgacaactgggaaatgataggagttatgctaccagaatca
gaccaatcatttaaagaaattgtagacacaatagaagaatataataaaatttatatattt
gatgatgaatatttacaaattatgaaagaacttcaaacatcatttcataactttgcagag
caatatccaaaagaatcttatccaagaacagaagatagtttaacattacaacaagctaga
aaaagctttaatcaagcatatgacaaattaatgatgtttgatataagacaagcagaagga
gtagtagctccataa

DBGET integrated database retrieval system