KEGG   Clostridium perfringens 13: CPE1140Help
Entry
CPE1140           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lar_restr_allev Stc1 DZR RNHCP
Motif
Other DBs
NCBI-ProteinID: BAB80846
UniProt: Q8XLA2
Position
1335177..1335464
Genome map
AA seq 95 aa AA seqDB search
MKELNLKSLWIEKKKGDLYYCPKCREYLEKDKFHNSKASKYGITSYCKSCDKIRRRIEFE
KRALAEVLGVQRTKEEVNRDKFKKCNKCGETKSIE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattaaatttaaaatcactttggattgaaaaaaagaaaggtgacttatattat
tgccctaaatgcagagagtatttagaaaaagataaatttcataatagcaaagcttctaaa
tatgggataactagttattgcaaatcatgtgataaaataagaagacgtatagagtttgaa
aaaagagctttagctgaggtgttaggagttcaaagaacgaaagaagaagtaaatagagat
aagtttaaaaaatgcaacaaatgtggtgaaactaaatctatagaataa

DBGET integrated database retrieval system