KEGG   Clostridium perfringens 13: CPE1141Help
Entry
CPE1141           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 7tm_3
Motif
Other DBs
NCBI-ProteinID: BAB80847
UniProt: Q8XLA1
Position
1335992..1336501
Genome map
AA seq 169 aa AA seqDB search
MKTNAINLFNFVLFISFSCIFIKNWFIYKRLFSNESYYINPSIKKDIQKLTLFKFLSVII
QLTVVATLQLILFFYTNKINFFNIAALYFLIYAFNLSISINNDYIYRNFKLIKKSDIDYF
NLDYKNNIVKIYLKGKKKPIIIAFKKDLSNLAKLLNKLGYKELLTRKNF
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaacgctattaacttatttaactttgtgctttttatatctttttcatgtatt
tttataaagaattggtttatttataaaagattattttctaatgaatcctattatattaat
ccaagcataaaaaaggatatacaaaagcttacattattcaaatttttatctgtaattata
cagttaacagtagttgcaactttacaattaatattatttttttatacaaacaaaattaat
ttttttaatatagcagctttatattttttaatatatgcctttaatttatcaatctctata
aataacgattatatttatagaaattttaaattaataaaaaagtctgatatagattatttt
aatttagattacaaaaataatattgtaaagatatatttaaaaggtaaaaagaaaccaatt
ataatagcatttaaaaaagacttatctaatttggcaaagcttttaaataaattaggatat
aaagaacttttgactaggaaaaatttttaa

DBGET integrated database retrieval system