KEGG   Clostridium perfringens 13: CPE1143Help
Entry
CPE1143           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAB80849
UniProt: Q8XL99
Position
1337651..1337983
Genome map
AA seq 110 aa AA seqDB search
MGLFSKNKERKGYTSIDSYLKENNLDNDIKSVTNVNIFFMDGEEEDFYLEDHMLLKFKNF
IENPEKDFLVLKYYSSLYSDGFSLEEITLMRHGICRFRIDSEKENILVSD
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggggttatttagtaaaaataaagaaagaaaaggttatacttctattgattcctattta
aaagaaaataacttagataatgatattaaatctgtaacaaatgttaatatattttttatg
gatggagaagaagaggatttttatttagaagatcatatgcttttaaaatttaaaaacttc
atagagaatccagagaaagattttttagtattgaaatattattcctcattgtatagtgat
ggttttagccttgaagaaattactttaatgagacatggaatatgtagatttagaattgat
agtgaaaaggaaaatatacttgtatctgattaa

DBGET integrated database retrieval system