KEGG   Clostridium perfringens 13: CPE1145Help
Entry
CPE1145           CDS       T00074                                 

Definition
(GenBank) CitG protein
  KO
K05966  triphosphoribosyl-dephospho-CoA synthase [EC:2.4.2.52]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CPE1145
Enzymes [BR:cpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.52  triphosphoribosyl-dephospho-CoA synthase
     CPE1145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CitG
Motif
Other DBs
NCBI-ProteinID: BAB80851
UniProt: Q8XL97
Position
complement(1339126..1339986)
Genome map
AA seq 286 aa AA seqDB search
MSINQEVFLEKLNSLIIKSLLYEVSCYPSPGLVSPISNGAHKDMDYYTFLDSISVIGPKF
REIAEISMSDIQVSDLLNKIRPIGLKIEEAMFHVTNNINTHKGLIFLMGVVCAATSKAFY
EGKPFKEIRNLIKEMTSGLVSKELNLKTNKKNETYGEKIFRLYGITGIRGEVEKGLPAVF
DYSLPFYMENKNLKTNERLYLTLFCIMANCEDSTLLHKNDIYVLEEVKKRSQEILNMIHS
KEPEIIKEKIFEIDKEFSERGISPGGSADLLAITVFLDGIKKYFPL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
ttgagtattaaccaagaggttttcttagaaaaactaaacagtttaataataaaatcctta
ttatatgaggtaagctgttacccctccccaggattagtatctccaatttcaaatggagca
cataaggatatggattactacacttttttagatagcatctcagtaattggtcctaaattt
agagaaatagcagaaataagtatgtcagatatacaagtaagtgatttattaaataaaata
cgtccaattggattaaaaatagaagaagctatgtttcatgttacaaataatataaataca
cataaaggtttgattttcttaatgggtgttgtttgtgcagcaacatcaaaagcattttat
gaaggtaaaccttttaaagaaataagaaatttaataaaagagatgacaagtggtttagtt
tctaaggaattaaacttaaaaactaataagaaaaatgaaacttatggtgaaaagatattt
agattatatggtataacagggataagaggagaagttgaaaaaggacttccagctgtgttt
gattatagccttcctttttatatggagaataaaaatttaaaaacaaatgaaaggctgtat
ttaacattattttgcataatggctaattgtgaagattctacacttttacataaaaatgat
atttacgttttagaagaggttaagaaaaggtctcaagaaatacttaatatgatacattct
aaagaacctgaaatcataaaagaaaaaatatttgaaattgataaggagttttcagaaaga
ggcataagccctggaggcagtgcagatttattggcaataactgtgtttttagatggaata
aaaaaatattttcctttataa

DBGET integrated database retrieval system