KEGG   Clostridium perfringens 13: CPE1146Help
Entry
CPE1146           CDS       T00074                                 

Definition
(GenBank) citrate (pro-3S)-lyase ligase
  KO
K01910  [citrate (pro-3S)-lyase] ligase [EC:6.2.1.22]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CPE1146
Enzymes [BR:cpe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.22  [citrate (pro-3S)-lyase] ligase
     CPE1146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_ly_lig HIGH_NTase1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_1 CTP_transf_like FAD_syn FR47 DUF1966 Acetyltransf_9
Motif
Other DBs
NCBI-ProteinID: BAB80852
UniProt: Q8XL96
Position
1340264..1341301
Genome map
AA seq 345 aa AA seqDB search
MSEWNYENTFEEELTFFSFNPQINKKYKFQVEEFLKKENLRFVKSINFTVCVFNNKELIA
TGSLDEYILKCFAVRSDYRKKGISEKILRILTEKAFENGETHLFIYTKPKNSKLFESLGY
HQLINIPNLVSLLENKSTGIRTYILNLQKKSYLQGVKVASIVMNCNPFTNGHKYLIEKAS
KENDVVHLFILTEDKSEFSTKDRINMVKLGTKHLKNVLIHEAGKYIISSATFPSYFIKEQ
KNITKAHAYLDLTLFCEYISKALNIKYRYVGEEPFSNLTNEYNQYMKEILPKHNIQVIEV
KRLKEDGQAISASSVRSFLKEGNLEKVESLVPKTTFDYLLNISKK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaatggaattatgaaaatacttttgaagaggagttaactttcttttcctttaat
ccacaaataaataaaaaatataaatttcaagttgaagaatttttaaagaaagaaaatttg
cgatttgtaaaaagtattaactttacagtgtgtgtatttaataataaagagcttatagct
actggatccttagatgaatatatactaaaatgttttgctgttagaagtgattatagaaaa
aaaggcattagtgagaagatattaagaatattaacagaaaaagcttttgaaaatggagaa
acacatctttttatatacacaaaaccaaagaactcaaagctttttgaaagtctaggttat
caccaattaataaatattcctaatttagtttctctattagaaaataaatcaacaggaatt
agaacttatatacttaatttacaaaaaaaatcttatctacaaggagtaaaggtagcttca
atagttatgaattgtaatccatttacaaatgggcataagtatttaattgaaaaagcttca
aaggaaaatgatgttgttcatttatttatattaacagaagataaatcagaattttctact
aaagatagaattaacatggttaaacttggaactaaacatctaaaaaatgttttaatacat
gaggcgggaaaatatattatttcaagtgccacatttccttcatactttataaaagaacaa
aaaaatattacaaaagctcatgcttatttagatttaactttattttgtgagtatatatca
aaagcattaaacattaaatacagatatgtaggagaagaacctttttcgaatttaacaaat
gaatataaccaatatatgaaagagatacttcctaaacataatatacaagtcatagaagtt
aaaagattaaaagaagatggtcaagcaatttcagcttctagtgtaaggagttttttgaaa
gaaggaaatctagaaaaagtagagagtttagttcctaaaacaacatttgattatttatta
aacataagtaaaaaataa

DBGET integrated database retrieval system