KEGG   Clostridium perfringens 13: CPE1147Help
Entry
CPE1147           CDS       T00074                                 

Definition
(GenBank) citrate lyase acyl carrier protein gamma subunit
  KO
K01646  citrate lyase subunit gamma (acyl carrier protein)
Organism
cpe  Clostridium perfringens 13
Pathway
cpe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CPE1147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP
Motif
Other DBs
NCBI-ProteinID: BAB80853
UniProt: Q8XL95
Position
1341325..1341630
Genome map
AA seq 101 aa AA seqDB search
MEIKKPALAGTLESSDCIVSVEPSMDNTIEINLTSTVKKQFGNEIIKVAKETLKNLGVNS
VVMEINDKGALNCVIEARIEAAVCRASEINEFDWGNYKCQD
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaaaaccagctttagctggaacattagaatcaagtgattgtatagtttca
gtagagccttcaatggataacactattgaaattaatttaacaagtactgtaaaaaagcaa
tttggaaatgaaattataaaggttgcaaaggaaaccttaaaaaacttaggagttaacagt
gttgttatggagataaatgataagggagccttaaattgtgttattgaagcacgtatagaa
gcggcagtatgtagagcttcagaaataaatgaatttgattgggggaattataaatgccaa
gattaa

DBGET integrated database retrieval system