KEGG   Clostridium perfringens 13: CPE1150Help
Entry
CPE1150           CDS       T00074                                 

Definition
(GenBank) probable CitG protein
  KO
K05964  holo-ACP synthase [EC:2.7.7.61]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CPE1150
Enzymes [BR:cpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.61  citrate lyase holo-[acyl-carrier protein] synthase
     CPE1150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CitX
Motif
Other DBs
NCBI-ProteinID: BAB80856
UniProt: Q8XL92
Position
1344090..1344602
Genome map
AA seq 170 aa AA seqDB search
MNEKNKFLIEILKGREERAFEIKKLNEKFHGTIICLTLNIPGPDKLDELYYYAFNEATKA
LEASLNINVLKERAPLSGYEAYFVSDKDIKEIKRLALTLEKEHPLGRLFDIDIFYKDLSK
ISREDLGEPKRKCFLCGEEAVSCGRSRKHSVYELTSSIKEKILKYKNSKN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaagaataaatttttgatagaaatattaaaaggcagagaagaaagagcattt
gaaataaaaaaactaaatgaaaaatttcatggaactattatatgtttaacattaaatatt
cctggtccagataaattggatgaactttattattatgcatttaatgaagccactaaggca
ttggaggcttcattaaatataaatgttttaaaagaaagagctcctctttctggatatgaa
gcttattttgtttcagataaggatataaaagaaataaaaagattagctttaactttagag
aaagaacatcctttaggaaggttatttgatatagatatattctataaagatttatctaaa
ataagcagggaagatttaggagagccaaaaagaaaatgttttttatgtggagaagaggca
gtttcctgtggaagaagtagaaagcattcagtttacgagcttacttcaagtataaaagaa
aaaatacttaagtataaaaacagtaaaaattaa

DBGET integrated database retrieval system