KEGG   Clostridium perfringens 13: CPE1151Help
Entry
CPE1151           CDS       T00074                                 

Definition
(GenBank) probable malate oxidoreductase
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00620  Pyruvate metabolism
cpe01200  Carbon metabolism
cpe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPE1151
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CPE1151
Enzymes [BR:cpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     CPE1151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M Shikimate_DH AlaDh_PNT_C ThiF FAD_binding_3 Pyr_redox_3 NAD_binding_8 Sacchrp_dh_NADP ELFV_dehydrog Pyr_redox_2 DAO TrkA_N HI0933_like NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: BAB80857
UniProt: Q8XL91
Position
1344643..1345788
Genome map
AA seq 381 aa AA seqDB search
MTKDELLKQRELAHGLISINPNFDINNREQLSQIYTPGVSTICKEVEHHHNMVKTLTSVG
NSIAVITDGTAVLGLGNIGTLAGYPIVEAKALVYKDLAGVNAIPLCVDQIGCNELIKTIK
SISPSFSGIHLEDIKAPECFYIEEELKKTLNIPVYHDDQHGTAIAVLGALYNGAKVVNKD
FLKLKVLILGAGASGIATAKLLLKAGIEDIILVDKNGALVNGDETLNAPQKEMAKITNKE
FKKGTLKEVIKGRDVFIGLSEGNLVTKEMVESMNEDPIIFALANPTPEIKPEIAKEAGAR
VIATGGPSYPNQINNILVFPGLFKGLLEAKATDVTCDVMIAVGKKLASLVENPTAEKIIP
GVFDGDIVKSVSETVVKNIEN
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggacgaattgttaaaacaaagagaattagctcatggattaataagtataaac
cctaatttcgatataaataatagagaacaattatctcaaatatatactccaggagtatca
actatttgtaaagaagttgagcatcatcataatatggtaaaaacactaacttctgttgga
aattcaatagctgttataacagatggtacggcggttttaggtcttggaaatataggaacc
cttgcaggatatcctatagtagaggctaaagctctagtttataaagacctagctggtgta
aacgctatacctttatgtgttgatcaaataggatgtaatgaactgattaaaactataaaa
agtatatctccaagttttagtggaattcatcttgaagatataaaggcaccagaatgtttt
tatatagaagaggaacttaaaaagactttaaacattccagtttatcatgatgatcaacat
ggtactgccattgctgttttaggtgctctttataatggagctaaggtggttaataaggat
tttttaaaattaaaggtattaattttaggggcaggagcttcagggattgcaacagcaaaa
ttattattaaaggctggaatagaagatattatattagttgacaaaaatggtgctttagtt
aatggggatgaaactcttaatgctcctcaaaaggaaatggctaaaataacaaataaagaa
tttaaaaaaggaactttgaaagaggtaattaaaggacgagatgtgtttataggtttatca
gaaggaaatcttgtaactaaggaaatggtagaaagtatgaatgaggatcctataatattt
gctttagctaatccaacaccagagataaaacctgaaattgcaaaggaagctggtgcaagg
gttattgcaacaggtggaccttcttatccaaatcagattaataatatattagtattccca
ggattatttaaaggcttattagaagctaaggcaactgatgtaacttgtgatgtaatgata
gcagttggcaaaaaactagcttccttagttgaaaatccaactgctgaaaaaataatacct
ggagtatttgatggtgatatagttaagtctgtttctgaaactgtggttaaaaatattgag
aattag

DBGET integrated database retrieval system