KEGG   Clostridium perfringens 13: CPE1152Help
Entry
CPE1152           CDS       T00074                                 

Definition
(GenBank) probable citrate/sodium symporter
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2HCT
Motif
Other DBs
NCBI-ProteinID: BAB80858
UniProt: Q8XL90
Position
1345809..1347149
Genome map
AA seq 446 aa AA seqDB search
MELQNKKIDGKEESLLKKFFNINLFGVPMLLFLVGAIIIILGISTNSLPKDMVGSIFLIF
TCGIVLGKIGDSIPIWKDYLGGGAILAFLVTSYAVYIGLIPTTYVKDVKTLFDSGFLELY
ISIMICGSLLAIDRKFLAKTVGGFIPMVLIATLTAALGAVIGGLITGVSPKEVILNYALP
IMGGGNGAGAIPMSQIWGQVTGKDPKIWYSSAMAILTIANIIAILAGAILNGIGNKKPQL
TGNGELIKGAKNAESTKSNFKATFEDGAAGLFITLAFYCLGNLFGKGFFPTIGGVFIHPF
AYMVVFVLIASGFNLVPERIRVGAKQVQKFMVGNLFYVLIAGVGIAMVDFGALLKAFNLT
TVIISLGAVIGAILGPWITSKIFGFYPIEASIAAGLCHVNRGGSGDLEILGAAKRMNLMA
YAQIATRLGGAIILVLAGFLFSLWLK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggaattacaaaataaaaagatagatggtaaagaagagagcttacttaaaaagtttttt
aatataaatctttttggggttccaatgttattgtttttagttggagcaataatcataata
ttaggtatatcaacaaattcattaccaaaggatatggttggaagtatatttttaatattt
acttgtggtattgttttaggtaaaataggtgattcaatacctatttggaaagattattta
ggtggaggggctatcttagcattcttagtaacttcatatgcagtttacataggattaatt
cctaccacttatgtaaaggatgtcaaaaccctttttgatagtggatttttagagttatat
atttcaataatgatttgtggttctttattagcaatagatagaaaattcttagcaaaaact
gttggaggttttatacctatggtgcttattgcaaccttaactgctgccttaggtgctgta
ataggaggattaattacaggagtttctccaaaagaagttatattaaattatgcacttcct
attatgggtggtggaaatggagccggtgctattcctatgagccaaatttggggacaagta
acaggaaaagatccaaagatatggtattcatcagcaatggcaatattaacaattgcaaac
ataattgcaatattagcaggtgctattttaaatggtataggtaataaaaaacctcagctt
acagggaatggagaattaattaaaggagcaaaaaatgcagaatctacaaaatctaatttt
aaagcaacctttgaagatggagccgcaggtctatttataacacttgctttctactgttta
ggaaatctatttggaaaaggattcttcccaacaataggtggagttttcattcatccattt
gcttacatggttgtatttgtgttaatagctagtggatttaacttagttccagaaagaatt
agagttggtgcaaaacaagttcaaaaatttatggttggtaatttattttatgttttaata
gcaggagttggtatagcaatggttgattttggagctttattaaaggcattcaatttaaca
actgttataatatctttaggtgcagttataggagctatattaggtccttggataacttca
aaaatatttggtttctatcctatagaagcttccatagcggcaggattatgccatgttaat
aggggaggttctggagacttagaaatattaggagctgctaagagaatgaatttaatggca
tatgctcaaatagcaactagacttggtggagcaattatattagttttagcaggattccta
tttagtttatggctaaaataa

DBGET integrated database retrieval system