KEGG   Clostridium perfringens 13: CPE1153Help
Entry
CPE1153           CDS       T00074                                 

Definition
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00620  Pyruvate metabolism
cpe00640  Propanoate metabolism
cpe00650  Butanoate metabolism
cpe01100  Metabolic pathways
cpe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPE1153
   00640 Propanoate metabolism
    CPE1153
   00650 Butanoate metabolism
    CPE1153
Enzymes [BR:cpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     CPE1153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFL-like Gly_radical DUF3029
Motif
Other DBs
NCBI-ProteinID: BAB80859
UniProt: Q8XL89
Position
1347518..1349752
Genome map
AA seq 744 aa AA seqDB search
MFKQWEGFKEGVWQNGIDVRNFIQKNYTAYEGDKSFLEGTTKRTDAVLEKAQKLIIEEIE
KGIIDVATDRVSGIDNYEPGYLDKDNEVIVGFQTDAPLKRIVNPFGGMRMVESSLKEYGY
ELDSSIREHFNAYRKTHNQGVFDAYSAETRAARSAGLLTGLPDAYGRGRIIGDYRRIALY
GIDYLIEEKKKDYANISFESEGSVEEYIQLRENVSEQIRALEAIKSMAARYGFDISKPAA
NAKEAVQFLYFGYLAAVKENNGAAMSLGRTSTFLDIFIERDLKAGTLTELEAQELIDQFI
IKLRLVRHLRTPEYNDLFAGDPTWVTEGIGGMGVNGKPLVTKNSFRYLQTLINLGPAPEP
NMTVLWSDRLPEGFKKFCAEVSIKTDSIQYENDELMRPIYGDDYSIACCVSAMQIGKQMQ
FFGARTNLAKALLYTINGGIDEKSGKVVIKGLEPITDEVLDYDKLRANYDKVLEYVAKLY
VDTMNVIHYMHDKYAYEAGQMALHDTHVGRLMAFGIAGLSVVADSLSAVKFAKVKPIREN
GIAVDFEIEGDFPKYGNDDDRVDDLAVEIVRKFSSELKKHPLYRGAKHTLSILTITSNVV
YGKKTGSTPDGRKAGEAFAPGANPMHGRDNSGALASLNSVAKIPYCEVCEDGVSNTFSIV
PDALGKEEDSRIDNLVAIMDGYFKQGAHHLNVNVFNRETLMDAMEHPEKYPTLTIRVSGY
AVNFNRLTRNQQLEVISRTFHDSL
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaacaatgggaaggctttaaagaaggagtatggcaaaatggaatagatgttaga
aacttcatacaaaagaactatactgcatatgagggagacaagagtttcttagaaggaaca
acaaaaagaactgatgcagttttagaaaaagctcaaaagttaattatagaagaaatagaa
aaaggcattatagatgttgctacagatagagtatctggaatagacaattatgagcctgga
tatttagataaagataacgaagttatcgttggtttccaaacagatgcaccacttaaaaga
atagttaatcctttcggtggaatgagaatggttgaaagttctttaaaagaatacggctat
gaattagatagcagtataagagaacactttaatgcttatagaaaaactcataaccaaggt
gtattcgatgcatactcagctgaaacaagagctgcaagatctgctggtcttttaactggt
cttccagatgcttatggtaggggaagaattataggtgactatagaagaattgccctttac
ggtatagattatctaatagaagaaaagaaaaaagattatgctaatatatcatttgaaagc
gaaggctcagtagaggaatatattcaattaagagagaatgtttcagagcaaataagagct
ttagaagcaataaaatcaatggctgcaagatatggctttgatatatctaaaccagctgca
aacgctaaggaagcagttcaattcttatactttggatacttagctgcagttaaagaaaat
aatggagcagcaatgtctctaggaagaacttctactttcttagatattttcatagaaaga
gatcttaaggcaggaactttaactgagttagaagctcaagaattaatagatcaatttata
ataaaattaagattagttagacacttaagaactcctgagtataatgatttatttgctgga
gacccaacttgggtaacagaaggtattggaggtatgggtgtaaatggtaaaccattagta
actaaaaactcatttagatatcttcaaactttaataaacttaggacctgctccagaacca
aatatgactgttttatggtcagatagattaccagaaggattcaaaaaattctgtgctgag
gtatcaattaaaactgactcaattcaatatgaaaatgatgagttaatgagacctatatac
ggagatgattactcaatagcttgttgtgtatcagcaatgcaaattggtaagcaaatgcaa
ttcttcggagctagaactaacttagctaaagctttactttacactataaatggtggtatt
gatgaaaaatcaggtaaagttgttattaaaggtttagagccaataacagacgaagtttta
gattatgataaattaagagctaactatgataaagttttagagtacgttgctaagctttat
gtagatacaatgaatgttatccactacatgcatgataaatatgcttatgaagctggacaa
atggctttacatgatactcatgtaggaagattaatggcatttggtatagctggtttatca
gttgtagctgactcattaagcgcagttaaattcgctaaagttaaacctataagagaaaat
ggaatagctgtagactttgaaatcgaaggtgacttccctaaatacggaaatgatgatgat
agagttgacgatttagctgtagaaatagttagaaagttctcaagtgagcttaagaaacat
ccattatatagaggtgctaagcacacattatcaatcctaactattacttcaaacgtagtt
tatggtaagaaaacaggttcaactccagatggaagaaaagctggtgaagcatttgctcca
ggagctaacccaatgcatggaagagataacagtggagctttagctagcttaaactcagtt
gctaaaattccatactgtgaagtttgtgaagatggtgtatcaaacacattctcaatcgtt
ccagatgctttaggaaaagaagaagattctagaatagataacttagttgctattatggat
ggttacttcaaacaaggagctcaccatctaaatgttaatgtatttaacagagaaacttta
atggacgctatggagcatcctgaaaagtatccaacattaacaatcagagtatcaggttat
gctgttaatttcaatagattaactagaaatcaacaattagaggttataagcagaacattc
cacgattctctataa

DBGET integrated database retrieval system