KEGG   Clostridium perfringens 13: CPE1154Help
Entry
CPE1154           CDS       T00074                                 

Definition
(GenBank) pyruvate formate-lyase activating enzyme
  KO
K04069  pyruvate formate lyase activating enzyme [EC:1.97.1.4]
Organism
cpe  Clostridium perfringens 13
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CPE1154
Enzymes [BR:cpe01000]
 1. Oxidoreductases
  1.97  Other oxidoreductases
   1.97.1  Sole sub-subclass for oxidoreductases that do not belong in the other subclasses
    1.97.1.4  [formate-C-acetyltransferase]-activating enzyme
     CPE1154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_12 Fer4_14 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: BAB80860
UniProt: Q8XL88
Position
1350038..1350745
Genome map
AA seq 235 aa AA seqDB search
MVKGRIHSLETMGLVDGPGIRFVVFMQGCGIRCAFCHNPDTWCKDKGTEYTPEELVNKIK
RFKTYFNASGGGVTFSGGEPLLQPEFLLECLKLCKKEGIHTTLDTAGVGLGNYEEILEYV
DLILFDVKETDPEKYKSLVGVPIDKSLEFLKVTQSMNKKMWIRHVVVPGYTDNKEDLMRI
KNFVDGLNNIEKVELLPYHVLGVNKYEGLNIPYRLEGVPPLDKKWLKELEKEIFN
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaggaagaattcattcattagaaactatgggcttagtagatggacctggtata
agattcgtagtttttatgcaaggctgtggaataagatgtgctttttgtcataatccagat
acttggtgtaaagataaggggactgaatatactccagaggagcttgtaaataagataaaa
agatttaaaacatattttaatgcatcaggtggtggtgttactttctcaggtggagagcct
cttcttcaaccagaatttttactagagtgtttaaagttatgtaaaaaggaaggaatacat
accacattagatactgcaggtgttggattaggaaattacgaagaaattcttgaatatgtt
gaccttatattatttgatgtaaaggaaactgatcctgagaaatataagagtttagtagga
gttccaatagataaatccttagagtttctaaaggtaactcagtccatgaataaaaaaatg
tggataagacatgttgtagttcctggatatacagataataaagaagatttaatgagaatt
aagaattttgtagatggtcttaataatatagaaaaggttgaacttttaccttatcatgtt
ttaggtgtaaataaatatgaagggcttaatattccatatagattagagggagttccacct
ttagataaaaagtggttaaaagaacttgaaaaagagatatttaattaa

DBGET integrated database retrieval system