KEGG   Clostridium perfringens 13: CPE1155Help
Entry
CPE1155           CDS       T00074                                 

Definition
(GenBank) DNA mismatch repair protein
  KO
K03555  DNA mismatch repair protein MutS
Organism
cpe  Clostridium perfringens 13
Pathway
cpe03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    CPE1155
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cpe03400]
    CPE1155
DNA repair and recombination proteins [BR:cpe03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Mismatch and loop recognition factors
     CPE1155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MutS_V MutS_I MutS_III MutS_IV MutS_II AAA_14 AAA_27 RNA_pol_Rpb6
Motif
Other DBs
NCBI-ProteinID: BAB80861
UniProt: Q8XL87
Position
1351007..1353736
Genome map
AA seq 909 aa AA seqDB search
MKLTPMMRQYFEIKENYKDCILFFRLGDFYEMFFEDAETAARELELVLTGRDCGLEKRAP
MCGIPFHASNSYIGRLVAKGYKVAICEQVEDPKVAKGIVKRDVIKVITPGTYTDSSFVEE
TKNNYIMTIYSDLERNRCSLAITDISTGDFLATEGELEKGVILDEISKFNPKEIILLDSL
DQELIKDITLTTPALISRKPIEYFEEKFEEVLNAQFGEKSNSLSLMVKKSSNALVKYILD
TQKISLTNINDIEVYSLVDFMTIDLSSRRNLELTENLREKSKKGSLLWVLDKTETSMGSR
MLRRWIEEPLVNKEKITLRLNAVEELFNDLSLNDSLKEALHDIYDIERILGKISNKNANA
KDLIALKTSIGKIPNVKGIIENCTSSLLRNYHHNLDDLRDIYELLEKSIKEDPSLTLKDG
DLIKDGFNSEIDELRLAKTNGKDWISSLENREREFTGIKSLKVGFNKVFGYYIEISKANY
SSIPEGRYIRKQTLANAERFITPELKEIEEKLLGASEKLCSLEYDIFLDIRNEVENHIDR
LKTTAKIIAELDCISNLAFVALENDFIKPEINEDGETKIENGRHPVVEKVIPKGEFIPND
TIINKDDNQLLIITGPNMAGKSTYMRQVAIITLMCQIGSFVPASKANISVVDKIFTRIGA
SDDLAGGKSTFMVEMWEVSNILKNATENSLVLLDEVGRGTSTYDGLSIAWSVIEYICKNK
NLRCKTLFATHYHELTKLEGEIHGVRNYSVAVKEVDNNIIFLRKIIEGGADQSYGIEVAK
LAGIPDDVINRAKEILEKLEMESSKDNLDLALKEVNASKEEMKEASITSSYEVKETLVEE
DKIEIKEEVISKASEAKTHKEDDQIQLDFSAIGKDNLIKELSEVDILSLNPMEAMNRLYA
LVKEAKNLI
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgactccgatgatgaggcaatattttgagataaaggaaaattataaggattgt
attctattttttagacttggagacttctatgagatgttctttgaggatgcagaaacagct
gcaagggaattagaattagttcttactggaagagattgtggcttagaaaaaagagcacct
atgtgtggaattccgtttcatgcatctaattcatatataggaagattagtagctaaagga
tataaggttgctatttgtgaacaagttgaagatcctaaagttgctaaaggaattgttaaa
agggatgttataaaggttataactcctggaacatatacagattcttcttttgttgaggaa
acaaaaaataattatataatgactatatattcagacttagagagaaatagatgttcacta
gctataacagatatttctactggagatttcttagctacagagggagaattagaaaaggga
gttattttagatgaaatatctaagtttaatcctaaagaaataatacttttagattcttta
gatcaagagcttataaaagatataacattaactactccagccttaataagtagaaagcct
atagaatattttgaggaaaaatttgaggaagtattaaatgctcaatttggagaaaaatca
aattctctaagtttaatggttaagaaatcaagtaatgctttagttaaatacatactagat
actcaaaaaataagcttaactaatataaatgatatagaagtatatagtttggttgatttt
atgactatagatttaagttctagaagaaatttagagcttacagagaatttaagagaaaaa
agcaagaaaggttctcttctttgggtattagataagacagaaacttctatgggaagtaga
atgcttagaagatggattgaagaacctcttgttaataaggaaaagataactttaagatta
aatgctgtagaagaattatttaatgatctttctttaaatgactctcttaaggaagcttta
catgatatttatgatatagagagaatattaggtaaaatttcaaataagaatgctaatgct
aaggatttaatagcattaaaaacttctataggtaaaattcctaatgtaaaaggaattata
gaaaattgcacttcaagtcttctaaggaattatcatcataatttagatgatttaagagat
atttatgaacttttagaaaaatctataaaagaagatccatctctaacattaaaagatggt
gatttaataaaagatggatttaatagtgaaatagatgaattaagacttgctaagactaac
ggtaaggattggatatctagtttagaaaatagagaaagagagtttactggcataaaatct
ttaaaggtaggatttaataaggtctttggttactatatagaaatatctaaggctaattat
agttctattcctgaaggaagatatataagaaagcaaactttagctaatgcagagagattt
attactccagaacttaaggaaatagaagaaaaacttttaggagctagtgaaaaactttgc
tctttagaatatgatattttcctagatataagaaatgaagttgaaaatcatatagataga
ttaaaaactactgctaagataattgctgaactagattgtataagcaatttagcctttgta
gctttagaaaatgattttataaaacctgaaattaatgaagatggggaaactaaaatagaa
aatggaagacaccctgttgttgaaaaggtaattcctaaaggagagtttattcctaatgac
actattataaataaagatgataatcaacttcttataataacaggtcctaatatggctggt
aaatcaacatatatgagacaggtagctattattactttaatgtgtcaaataggttccttt
gtaccagctagtaaggctaatataagtgtagtagataaaatctttactagaataggagct
tctgatgatttagcaggtggtaaaagtacatttatggttgaaatgtgggaagtttctaac
attttaaaaaatgctacagaaaatagcttggttcttttagatgaagttggaagaggaacg
agtacatatgatggattaagtatagcttggtctgttatagagtatatatgtaagaataaa
aatttaagatgtaaaactctttttgctactcattatcatgagttaactaaattagaagga
gaaattcacggagttagaaactattcagtagctgttaaggaagtggataacaatattatc
ttcttaagaaaaataatagaaggtggagcagatcaatcttatggtattgaggttgctaaa
cttgctggtattccagatgatgtaataaatagagctaaggaaatcttagagaaacttgaa
atggaatcttcaaaggataacttagatttagctcttaaagaagtaaatgcttcaaaagaa
gaaatgaaggaagcctctattacatcctcttatgaagttaaagaaactctagtagaagag
gataaaattgaaattaaagaagaagttatttcaaaagcttcagaggctaaaacacataaa
gaagatgatcaaatacaattagatttctctgccataggaaaagataatttaataaaagaa
ctttcagaagttgatattttatctttaaatcctatggaggctatgaatagattatatgct
ctagttaaagaagctaaaaatttaatttag

DBGET integrated database retrieval system