KEGG   Clostridium perfringens 13: CPE1157Help
Entry
CPE1157           CDS       T00074                                 

Definition
(GenBank) tRNA isopentenylpyrophosphate transferase
  KO
K00791  tRNA dimethylallyltransferase [EC:2.5.1.75]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe01100  Metabolic pathways
cpe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:cpe01006]
    CPE1157
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpe03016]
    CPE1157
Enzymes [BR:cpe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.75  tRNA dimethylallyltransferase
     CPE1157
Prenyltransferases [BR:cpe01006]
 Compound prenylation
  tRNA dimethylallyltransferase
   CPE1157
Transfer RNA biogenesis [BR:cpe03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    CPE1157
 Prokaryotic Type
    CPE1157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IPPT IPT AAA_18 AAA_33 Cytidylate_kin Hydin_ADK AAA_14 DUF327
Motif
Other DBs
NCBI-ProteinID: BAB80863
UniProt: Q8XL85
Position
1355805..1356737
Genome map
AA seq 310 aa AA seqDB search
MNNNLLIIAGPTAVGKSDLSVDLAKKLNGEIISVDSMQIYKYMDIGSAKISKEEMGGIPH
YLIDFVDPSKEFSVAEFKDLTTEKIKDIQSRGKLPILVGGTGLYINSIICNMNFAESDKD
EEYREELEKIANEHGNEYLHEMLKDIDLESYNSIHFNNRKRVIRALETYKLTGKPFSSFK
AKNSIYETPYNIYYYVLNMDRAKLYDRINKRVDIMFEKGLLEEVKNLKAMGLTDDMQSMK
GIGYKEVLYYLDGKISLEQCIEMIKQGSRNYAKRQLTWFRKDPRAIFIDKDTFASEEDIS
SKIINDIINS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaataataatttacttattattgctgggccaacagccgtaggaaaaagtgacctttca
gtagatctagcaaagaagctaaatggtgaaataatctctgttgactctatgcaaatatat
aaatacatggatataggttcagctaaaatttctaaggaagaaatgggaggtattcctcac
tatttaatagattttgttgatcctagtaaggaatttagtgtagctgaatttaaagactta
actacagagaaaattaaagatatacaaagtagagggaaacttcctatattagtagggggc
actggactatatataaattcaatcatatgcaatatgaattttgcagaaagtgataaggat
gaagagtatagagaagagcttgaaaaaatagctaatgagcatggaaatgaatatttgcat
gaaatgctaaaagatattgatttagaaagctataattcaatacattttaataatagaaaa
agagtaattagggcattagaaacttataagttaactggaaaaccattttcatcttttaaa
gctaagaatagtatttatgaaactccatataatatatattattatgtacttaatatggat
agagcaaagctttatgacagaataaacaaaagagttgatataatgtttgaaaaaggtctt
ttagaagaggttaagaatcttaaagccatgggattaactgatgatatgcaatcaatgaaa
ggtataggatacaaagaagttttatattatcttgatggtaaaatctctttagaacaatgc
atagagatgattaagcaagggagcagaaactatgctaaacgtcagcttacttggtttaga
aaggatcctagagctatatttatagataaagatactttcgcctctgaagaagatatttct
tccaaaattattaatgacataataaattcttag

DBGET integrated database retrieval system