KEGG   Clostridium perfringens 13: CPE1177Help
Entry
CPE1177           CDS       T00074                                 

Definition
(GenBank) orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00240  Pyrimidine metabolism
cpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CPE1177
Enzymes [BR:cpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.10  orotate phosphoribosyltransferase
     CPE1177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase
Motif
Other DBs
NCBI-ProteinID: BAB80883
UniProt: Q8XL65
Position
complement(1373711..1374289)
Genome map
AA seq 192 aa AA seqDB search
MKNTDAMVIDTLKEVGALLEGHFLLSSGRHSNRYCQCAQLLKYPEKAEKVLKVVADQLKD
IDFDLVVGPAMGGVIVAYELGRQLGKPAIFTERENGEMTLRRGFTIEKGQKVVITEDVVT
TGKSFKEAAKVIEEQGGEVVAVVCIVDRTPGNVTDFPMYSSIKLDIESFEAENCPLCKEG
VPYIKPGSRNIK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatacagacgctatggttatagatacattaaaagaggttggagcattattagaa
ggacatttcttattatcatcaggaagacactcaaatagatattgccaatgtgctcaatta
ttaaaatacccagaaaaagctgagaaagtattaaaggttgtagctgatcaattaaaagat
atagactttgacttagttgtaggaccagctatgggaggagttatagtagcttacgaatta
ggaagacaattaggtaagcctgcaatctttactgaaagagaaaatggagaaatgactcta
agaagaggatttactatagaaaaaggacaaaaagtagtaataacagaggatgttgtaact
acaggtaagagctttaaggaagctgcaaaggtaattgaagaacaagggggagaagttgtt
gcagtagtttgtatagtagatagaactccaggcaatgtaacagatttcccaatgtatagt
tcaataaaacttgatatagaaagctttgaagcagaaaattgcccactatgtaaagaagga
gtgccttacataaaaccaggaagcagaaatataaaataa

DBGET integrated database retrieval system