KEGG   Clostridium perfringens 13: CPE1180Help
Entry
CPE1180           CDS       T00074                                 

Definition
(GenBank) orotidine-5'-monophosphate decarboxylase
  KO
K01591  orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00240  Pyrimidine metabolism
cpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CPE1180
Enzymes [BR:cpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     CPE1180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase
Motif
Other DBs
NCBI-ProteinID: BAB80886
UniProt: Q8XL62
Position
complement(1376124..1376987)
Genome map
AA seq 287 aa AA seqDB search
MIADKLFEKVEKNGVVCVGLDTSLDYIPEEFKSKFSNESDMLFAFNKEIIDATLDVSACF
KVQIAYYEALGLKGLEAYKNTLSYLREKNALIIADIKRGDIAATAKMYAKAHFEGDFESD
FITLNPYMGMDSIDPYLPYIEKNEKGVFVLVRTSNKGAEDIEYLEAGHGKKVYDVVGEKL
NTLGKNYLGKHGYSSIGGVVGCTHQEEAKEMRDKLDTMPFLIPGYGAQGGTAKDVAAYLK
NGNGGIVNSSRKILLAYKAMEDNKNFAECARKEAISMRDSIREAILK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgatagctgataaattatttgaaaaagtagaaaaaaacggagtagtttgtgttggacta
gatacaagcttagattatataccagaggagtttaaaagtaagttttcaaatgaaagcgat
atgttatttgccttcaataaagaaataatagatgccacactagatgtatctgcatgtttt
aaagttcaaatagcttattatgaagctcttggtcttaaaggattagaagcttataaaaat
accttaagttatttaagagaaaagaatgctttaatcatagctgatataaaaagaggggat
atagctgcaacggctaaaatgtacgcaaaggctcactttgaaggggattttgaaagtgat
tttataactctaaatccatatatgggaatggatagcatagatccatacttaccttatata
gaaaaaaatgaaaaaggagtatttgtactagtaagaacttcaaataaaggagctgaagat
atagagtatctagaggctggacatggaaagaaagtttatgatgtagttggagaaaagtta
aatactctaggaaaaaactatttaggaaaacatggttatagttcaataggtggagttgta
ggttgtactcatcaagaagaagcaaaagaaatgagagataaattagatacaatgccattt
ttaatacctggatatggtgcacagggaggaactgctaaagatgtagcagcttatcttaaa
aatggaaatggtggaattgtaaactcttcaagaaagatactattagcctataaagctatg
gaagataataaaaactttgcagaatgcgctagaaaagaagccatttcaatgagagacagt
ataagagaagcaattttaaaatag

DBGET integrated database retrieval system