KEGG   Clostridium perfringens 13: CPE1183Help
Entry
CPE1183           CDS       T00074                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00240  Pyrimidine metabolism
cpe00250  Alanine, aspartate and glutamate metabolism
cpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CPE1183
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CPE1183
Enzymes [BR:cpe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CPE1183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: BAB80889
UniProt: Q8XL59
Position
complement(1378381..1379304)
Genome map
AA seq 307 aa AA seqDB search
MLKNKHLLDPSDFTIEEFDEIFKLAHQIMANPKEYQNICNGKILATLFYEPSTRTRLSFE
SAMLRLGGQVIGFSEPNSSSVSKGESLRDTIKTVNCYADLIAMRHPLEGAAKVASMYSDI
PVINAGDGGHQHPTQTLTDLLTIKEYKGNLEGNTIALCGDLKFGRTVHSLIKALSRYKNN
KFILISPIELRIPNYIREQILEKNNIEYKEITSLEEGIKEANILYMTRIQRERFVDQSEY
ERLKDVYVLDEAKMKGAKEDMMVLHPLPRVNEISYEVDEDSRAFYFKQAKCGMYVRMALM
AKLLGEA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaacaaacacttattagatccatcagatttcacaatagaggaatttgatgaa
attttcaaattagcacatcaaattatggcaaatccaaaagaatatcaaaacatatgcaat
ggtaaaattctagcaacacttttctatgagccaagcactagaacaagattatcttttgaa
tcagcaatgcttagactaggtggacaagttataggtttctcagaaccaaattcttcatca
gtttctaaaggagaatctttaagagatactattaaaacagtaaactgctatgcagatctt
atagcaatgagacatcctttagaaggagcagcaaaagttgcttcaatgtattcagatatc
ccagttataaatgcaggagatggaggtcatcaacatccaactcaaacattaacagatctt
cttacaataaaagaatataaaggaaacctagaaggaaatacaattgcattatgtggagac
ttaaaattcggtagaacagtgcattctcttataaaagcactttcaagatataaaaataat
aaattcatcttaatatctccaatagaactaagaatccccaattatattagagagcaaatt
ttagaaaaaaataatatagaatacaaagaaattactagcttagaagaaggaattaaggaa
gctaacattttatacatgacaagaatacaaagagaaagatttgtagatcaaagtgagtat
gaaagattaaaagatgtatatgtattagatgaagcaaaaatgaagggtgccaaagaagat
atgatggttcttcatcctcttccaagagtaaatgaaatatcctatgaagtagatgaagat
tcaagagcattttactttaagcaagccaaatgcggaatgtatgtaagaatggccttaatg
gcaaaacttttaggggaggcgtaa

DBGET integrated database retrieval system