KEGG   Clostridium perfringens 13: CPE1184Help
Entry
CPE1184           CDS       T00074                                 

Definition
(GenBank) probable beta-lactamase
  KO
K17836  beta-lactamase class A [EC:3.5.2.6]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00311  Penicillin and cephalosporin biosynthesis
cpe01130  Biosynthesis of antibiotics
cpe01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    CPE1184
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    CPE1184
Enzymes [BR:cpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     CPE1184
Antimicrobial resistance genes [BR:cpe01504]
 Gene sets
  beta-Lactam resistance modules
   beta-Lactam resistance, Bla system [MD:M00627]
    CPE1184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase2 Peptidase_S11 Transpeptidase
Motif
Other DBs
NCBI-ProteinID: BAB80890
UniProt: Q8XL58
Position
complement(1379716..1380495)
Genome map
AA seq 259 aa AA seqDB search
MKEVQKYLESRIGSYSFFFEDLKSGYTYGYNENVKMISAGCMKLPIAIALIKEVEEGKID
FLDKVKIESSDKVYGTGIIHEFGERDYTVFELMVAMLIQSDNTAANKIIDLVGMDKINET
IKEFGMKNTELNRKTADERNFKSDVENYTTAYDLTLAWKKLSEGSFLSKENSQMLIDILT
RQQIKNKLALYIPDNLKFDISSKTGDKKGVENDTALIHTQKGNFACTVMSSGIPNSVYGT
VTLAKSGKMTWDAIMNNWH
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagttcaaaaatatttagagagcagaattggttcgtatagctttttctttgag
gatttaaagagtggttatacttatggttataatgaaaacgttaaaatgatttcagcaggt
tgtatgaaattacctatagctatagctcttataaaagaagtagaggaaggcaaaatagac
tttttggataaagttaaaatagaaagttcagataaggtctatggaactggtataatacat
gagtttggagagagggattatactgtatttgaacttatggtagcaatgctaattcaaagt
gataatacagcagcaaataaaataattgatttagttggtatggataaaataaatgaaact
attaaggaatttggtatgaaaaatactgagcttaatagaaaaactgccgatgaaagaaat
ttcaaatcagatgtagaaaattatacaacagcttatgatttaactttagcctggaaaaaa
cttagtgagggttctttcttaagtaaagaaaactcccaaatgcttatagatatacttaca
agacaacagattaaaaacaaactagctttatatataccagacaatcttaagtttgatata
tcaagcaaaactggagacaaaaagggagttgagaatgatacggccttaattcatactcaa
aaagggaactttgcttgtacagtaatgtctagtggaattcctaactcagtctacgggact
gtgaccttggcaaagtctggtaaaatgacttgggacgccatcatgaacaattggcactaa

DBGET integrated database retrieval system