KEGG   Clostridium perfringens 13: CPE1185Help
Entry
CPE1185           CDS       T00074                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00010  Glycolysis / Gluconeogenesis
cpe00030  Pentose phosphate pathway
cpe00051  Fructose and mannose metabolism
cpe00052  Galactose metabolism
cpe00680  Methane metabolism
cpe01100  Metabolic pathways
cpe01110  Biosynthesis of secondary metabolites
cpe01120  Microbial metabolism in diverse environments
cpe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPE1185
   00030 Pentose phosphate pathway
    CPE1185
   00051 Fructose and mannose metabolism
    CPE1185
   00052 Galactose metabolism
    CPE1185
  09102 Energy metabolism
   00680 Methane metabolism
    CPE1185
Enzymes [BR:cpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CPE1185
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CPE1185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: BAB80891
UniProt: Q8XL57
Position
complement(1380727..1381827)
Genome map
AA seq 366 aa AA seqDB search
MMQPIKKIAILTGGGDCPGLNAVIRAVTRTAILKYGYEVIGYKFGYRGLYNNDFVKLDLD
SVSGILHRGGTILHSSNKDNLFDYQVEDENGKIVKKDVSDVGVENLKKEGVDALVVIGGD
GTLTSARDFSRKGVNVIGVPKTIDNDLLATDVTFGFNTATEIATEALDRLHTTAESHHRI
MLLEVMGRNAGWIALESGIAGSADVILLPEIPYDINKIVEKVKEREEAGKQFTIIVVAEG
AKPKDGEVVVSKIVDDSPDPIRLGGIANKLAIDLEGLIKNHEIRSTVLGHIQRGGNTSTY
DRILSTKYGVKAVELINSNLFGNMVALKGNKVSYESLENVIGHTKNVDPEGELVNTAKSI
GISFAD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaccaattaagaaaatagctatactaacaggaggaggagattgtcctggatta
aatgcagtaataagagctgtaactagaactgcaatcttaaaatatggatatgaagttata
ggttataaatttggatatagaggtctatataataatgactttgtaaaattggatcttgat
tctgtttctggaatacttcatagaggaggaacaatacttcatagttcaaataaggacaac
ctatttgattatcaagttgaagatgagaatggtaaaatagttaaaaaagatgtttctgat
gttggtgttgaaaacttaaagaaagaaggggtagatgctctagttgttattggaggagat
ggaaccttaacctctgcaagagatttctcaagaaaaggtgtaaatgtaataggtgttcct
aaaacaatagataacgatttattagccacagatgtaacctttggatttaatactgccaca
gaaatagctacagaagctttagatagacttcatactacagctgagtcacatcatagaata
atgcttttagaagttatgggaagaaacgctggttggattgctttagaatcaggaatagct
ggttctgctgatgtaatattattacctgaaataccttacgatataaacaagatagttgaa
aaagtaaaagaaagagaagaagccggaaaacagtttacaattattgtagttgcagaagga
gcaaaacctaaagatggagaagtagttgtttctaaaatagttgatgatagtccagaccca
ataagattaggaggaatagctaacaaattagctattgacttagaaggattaataaaaaat
catgaaataagaagcactgttcttggacatatacaaagagggggaaatacctctacttat
gatagaatactttccactaaatatggagttaaagctgttgaacttataaatagtaattta
tttggaaacatggttgcattaaaaggaaataaagtatcctatgaaagcttagaaaatgta
attggacatactaaaaatgtagatccagaaggtgaattagtaaacactgctaaaagcata
ggaattagtttcgctgattaa

DBGET integrated database retrieval system