KEGG   Clostridium perfringens 13: CPE1186Help
Entry
CPE1186           CDS       T00074                                 

Definition
(GenBank) probable bacitracin resistance protein
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CPE1186
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cpe01011]
    CPE1186
Enzymes [BR:cpe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     CPE1186
Peptidoglycan biosynthesis and degradation proteins [BR:cpe01011]
 Precursor biosynthesis
  Diphosphatase
   CPE1186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BacA DUF92 ESSS
Motif
Other DBs
NCBI-ProteinID: BAB80892
UniProt: Q8XL56
Position
complement(1382037..1382951)
Genome map
AA seq 304 aa AA seqDB search
MGIDFLFILKALIIAIVEGLTEFVPVSSTGHMILVGDLIHFNTQSGGFPEMYEVVIQLGA
ILAVVVLYWRKISSSVVEFLSYIFSFIGLKTSGDKRKYEKRLAESETGFRFGINVIIGTI
PAAILGLLFHDEIKEYLFSTKTVAIGFIVGGILLIVIENNFRKRAKRSKIVKDIDKMTYG
QSLLVGCFQCLSLWPGMSRSASTIMGGWISGLSTTVATEFTFFLAIPAMVGASGLDLFKF
DYSQMNATNWISLILGFIVAFIVSLVVIDKFINYLKKKPMRVFAIYRVFAGIVLAILIFT
KVIS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgggaattgattttttattcatacttaaggccttaataatcgcaattgttgaaggtctt
acagaatttgttcctgtttcctcaacaggacacatgattctagttggtgaccttattcac
tttaatacacaatcaggtggatttcctgaaatgtatgaagttgttattcaattaggtgcc
atactagcagttgtagtattatattggagaaagataagtagctcagtagttgagttttta
agttacatattttcatttatcggattaaaaacatcaggtgataaaagaaaatatgaaaaa
agacttgcagaatcagaaacaggttttagatttggtataaatgttattataggaacaata
ccagcagctattttagggcttttattccatgatgaaataaaagaatatttattttcaaca
aaaactgtagctataggatttatagtaggtggtatattacttatagttatagaaaataac
tttagaaaaagagctaaaagaagtaagattgtaaaagatattgataaaatgacatatgga
caatcattactagttggatgcttccaatgtttatctttatggcctggaatgtcaagaagt
gcatcaacaatcatgggaggatggatttctggattaagtacaactgttgctacagaattt
acatttttcttggcaataccagctatggttggagcttctggcttagatctatttaaattt
gattattctcaaatgaatgcaacaaattggatctcattaatcttaggctttatagttgca
tttatagtttcattagttgttatagataagtttataaattacttaaagaaaaaacctatg
agagtttttgctatatacagagtatttgctggtatagtattagctattttaatatttact
aaagtaattagttaa

DBGET integrated database retrieval system