KEGG   Clostridium perfringens 13: CPE1187Help
Entry
CPE1187           CDS       T00074                                 

Definition
(GenBank) mannose-6-phosphate isomerase
  KO
K01809  mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00051  Fructose and mannose metabolism
cpe00520  Amino sugar and nucleotide sugar metabolism
cpe01100  Metabolic pathways
cpe01110  Biosynthesis of secondary metabolites
cpe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CPE1187
   00520 Amino sugar and nucleotide sugar metabolism
    CPE1187
Enzymes [BR:cpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     CPE1187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMI_typeI Cupin_2 Cupin_3 DUF4302
Motif
Other DBs
NCBI-ProteinID: BAB80893
UniProt: Q8XL55
Position
complement(1383211..1384188)
Genome map
AA seq 325 aa AA seqDB search
MYPIRFENLYYDKVWGGRDFELFRDNMPEGMIGETWDVACHQNGMSIVENGEYKGLRFDE
LIDKLGSDLVGTEISKEKFPLLIKLINAKDKLSVQVHPNDEYGMRVEGELGKTEIWYVVE
AFEGANLIVGTKDCTKEQFVKAIETGEFDQYLNRVEVKKGDTFFVRSGLVHAICEGVIIA
EIQQNSDTTYRVYDYNRGREIHVEKALDCIDFSLKGEKAKGLKVSYDQYDKTYLSLCEYF
SLEKYDIHGVCEEESDKERFFIFTCVEGEGIITSEEGELAIKKGDSIFIPASLGKYSLKG
NMTLLKSYVPKEGAVEEEILSVVKA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtatccaataagatttgaaaacttatactatgataaagtttggggtggaagagatttc
gaacttttcagagacaatatgccagagggaatgataggagaaacttgggatgttgcttgt
catcaaaatggaatgagtatagttgaaaatggtgaatataaagggttaagatttgatgag
ttaatagataaattaggaagtgacttagtaggtactgaaatatcaaaagagaaatttcct
ctacttataaaattaataaacgctaaggataaattatcagttcaagttcatccaaatgat
gaatatggtatgagagttgaaggagagcttggaaaaactgaaatttggtatgttgttgaa
gcttttgaaggagctaatttaatagtaggaacaaaggattgtactaaagaacaatttgtt
aaagctatagaaactggtgaatttgatcagtatttaaatagagtagaagtaaaaaaaggg
gatactttctttgtaagaagtggactagttcatgctatatgcgaaggtgttataatagct
gaaatccaacaaaatagtgatacaacttatagagtatatgactataacagaggaagagaa
atccatgttgaaaaagctttagattgtatcgatttctcattaaaaggagaaaaagctaag
ggattaaaagtttcatatgatcaatatgataaaacttatctttcactatgtgaatatttc
tcattagaaaaatatgatatacatggagtatgtgaagaagagagtgataaagaaagattc
ttcatatttacatgtgttgaaggagaaggaatcataacttcagaagaaggagaattagca
attaaaaaaggagatagtatattcatacctgcatccttaggaaaatattctttaaaagga
aacatgacattattaaagagttatgttccaaaagaaggtgctgttgaagaggaaatactt
tcagtagtaaaagcttaa

DBGET integrated database retrieval system