KEGG   Clostridium perfringens 13: CPE1189Help
Entry
CPE1189           CDS       T00074                                 

Definition
(GenBank) probable cobyric acid synthase
  KO
K07009  uncharacterized protein
Organism
cpe  Clostridium perfringens 13
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    CPE1189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 GATase DJ-1_PfpI ThiJ_like
Motif
Other DBs
NCBI-ProteinID: BAB80895
UniProt: Q8XL53
Position
1385812..1386543
Genome map
AA seq 243 aa AA seqDB search
MELNICHLYPDLLNVYGDVGNILILKHRAKLRGIKVNVINVSMGDKFDKDNYDIVFFGGG
QDFEQSIVSDDLINLKKDVLKEYVEEGKVLLAICGGYQLLGNYYTAPTGEKIDGLGILDI
YTEGGDTRFIGNTVIHNEEFDETYVGFENHSGRTFIGDLKPLGKCIHGYGNNGESGYEGC
IYKNTFCTYFHGSLLSKNPELADRILTLALSNKYDDISLSPLDDTFEIKAKNVMIDRLNN
ENK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggaattaaatatatgtcacttatatcctgatctacttaatgtttatggagatgtagga
aatattttaatattaaagcatagagcaaaattgcgtggaatcaaagtaaatgtaataaat
gtttctatgggtgataaatttgataaagataattacgatatagtattctttggtggcggt
caagactttgagcaatcaatagtatctgatgatttaataaacttaaaaaaagatgtttta
aaagaatatgttgaagaaggaaaagttcttttagctatctgtggtggatatcaactttta
ggtaattattatactgcccctacaggagaaaaaatagatggcttaggaattttagatata
tatactgaaggtggagacactagattcataggtaacacagtaattcataacgaagaattt
gatgaaacttatgttggctttgagaatcactctggtagaacatttattggagatttaaaa
cctcttggaaaatgcattcatggttatggaaataatggggaaagtggttatgagggatgt
atttataaaaatactttctgtacatacttccacggatcacttttatctaagaatccagag
cttgcagatagaattttaacattagctcttagtaataaatatgatgatatttcattatca
cctttagatgatacttttgaaattaaagctaagaatgttatgatagatagattaaataat
gaaaataagtaa

DBGET integrated database retrieval system