KEGG   Clostridium perfringens 13: CPE1190Help
Entry
CPE1190           CDS       T00074                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease Phage_holin_2_1
Motif
Other DBs
NCBI-ProteinID: BAB80896
UniProt: Q8XL52
Position
complement(1386523..1388070)
Genome map
AA seq 515 aa AA seqDB search
MSSEHKSKLSLTALILMIFTSVYGFANMPKAFYLMGYSAIPWYIISALAFSIPYAFMMAE
YGAAFRKERGGIYSWMAKSVGPKYAFIVTFMWYSSNLIWLVSNSSSIWIPFSNVIYGKDT
TGTWSLLGLSVPQTMAVLGSILIIVITYASSKGLKSITKVTSIGGTVVALSNIVLILGAI
IVFVSNGFKPAEVINGAAFVHAQNPSYQSPIGVLGFLVFAVFAYGGLEAVSGLVDETKDA
KKNFPKGLMIASIIIAVGYAVGILCVGLFTNWQEVLSGDNVNLANVAYIVIQNLGVKLGQ
AFGMSTNASLQLGAWFARYIGLSMMLALMGAFFTLSYAPIKQLIEGTPKEIWPKKWTVLN
ENNMPVNAMWVQCIVVVIFILVASFGGESANKFFSYLILMGNVAMTIPYMFLSGAFPAFK
KKKHIEKPFVMYKSYKSSLIWSIIVTFTIGFANLFTIIKPVIQDKDYTAMAFQITGPIVF
SIIAFILYHNYEKKMKNRKNREESLFLKKLLIFII
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgagctcagaacataaaagtaaattgtctttaacagcgcttatattaatgattttcaca
tcagtatatggttttgctaacatgccaaaggccttttatttaatgggatatagtgctatt
ccatggtacataatatcagcattagctttctcaattccatatgcttttatgatggcagaa
tatggagcagcatttagaaaggaaagagggggaatatactcatggatggctaaatctgta
ggacctaaatatgccttcatagttacattcatgtggtattcatcaaatttaatatggtta
gttagtaactcatcatcaatatggattcctttctcaaatgttatatatggaaaagatact
acaggaacatggtctttacttggattaagtgttccacagacaatggctgtattaggatca
atacttataatagttataacttatgcatcatctaaaggcttaaagagtataacaaaggtt
acttcaattggaggaactgttgttgcattatcaaacatagtacttattttaggagcaatt
attgtttttgtaagcaatggatttaaaccagctgaggtaataaatggtgctgcctttgtt
catgcacaaaatccatcttaccaatcaccaataggtgtattaggatttttagtttttgca
gtttttgcttatggtggactagaagctgtaagtggattagttgatgaaactaaggatgct
aaaaagaattttccaaagggattaatgattgcatctataataatagccgttggatatgct
gttggaatactttgtgttggattatttacaaattggcaagaagtattatctggggataat
gttaacttagcaaacgtagcatatatagtaattcaaaacttaggtgtaaaattaggtcaa
gcttttggcatgagtactaatgcttcacttcaattaggagcttggtttgcaagatacata
ggtctttcaatgatgttagccttaatgggagctttctttacattaagttatgcacctatt
aaacaattaatagaaggaacacctaaagaaatctggccaaaaaaatggacagtgttaaat
gaaaataacatgccagttaatgcaatgtgggttcaatgtatagttgttgttatatttata
ttagtagcttcttttggtggagaatctgcaaataaattctttagttatttaatattaatg
ggtaatgtggccatgacaataccatatatgttcttatctggagcttttccagcatttaaa
aagaaaaaacatatagaaaaaccatttgttatgtataagtcatataaatcatcattaatt
tggtcaataatagtaacatttacaattggatttgcaaatttatttacaataataaaacct
gttattcaggataaagattatacagctatggcattccaaataactggtccaatagttttt
tctataattgcttttatactttatcataattatgaaaagaaaatgaaaaatagaaaaaac
agagaagaatctctgtttttaaaaaaattacttattttcattatttaa

DBGET integrated database retrieval system