KEGG   Clostridium perfringens 13: CPE1194Help
Entry
CPE1194           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HGD-D DUF2229 DUF1091 B12-binding_2
Motif
Other DBs
NCBI-ProteinID: BAB80900
UniProt: Q8XL48
Position
complement(1391335..1392597)
Genome map
AA seq 420 aa AA seqDB search
MEIENNKNFAVFTKEMRKTHTILAPTMLPIHFKLLSGIMKKYGYKLEFFDGDTNSAIEEG
LKSVHNDICYPAMIVIGQLMEALKSGKYDPDKTALIMSQTGGGCRASNYIHLLRKALKEN
NLEQVPVISLNASGLEKHEGFKMYPGLLIKCIYALYYGDLLMYMYNQCKSYEINKGETDK
VLDKWIEILKEKFESLKYLKVRELYKNIILDFSKIELEETEKVKVGIVGEIYLKYSPLGN
NNLEEFLREDNAEVVMSGVTDFFMYCLSNSEIDYKLYGMKKVSSKFTKIGCSYLEHLQNV
MIDSIKKYSNFRAPAPFKELKTSVEEYIGRGVKMGEGWLMTAEMLELINSGVNNIVCAQP
FGCLPNHIVGKGMIRGIMEKHPEANIVVVDYDPSSTKVNQENRIKLMLANAKLSEYILNN
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaaatagaaaataataaaaattttgcagtatttactaaagagatgagaaagactcat
actattttagctcctacaatgttgccaatacactttaaacttttatctggaataatgaaa
aagtacggttataaattagaattttttgatggtgatacaaacagcgccattgaagaagga
ttaaaaagtgttcataatgatatatgctatccagctatgattgtaattggacaacttatg
gaagctttaaaaagtggaaaatatgacccagacaaaacggctttaataatgagccaaact
gggggcggatgccgtgcatctaattatatacatttattaagaaaggcactaaaagaaaat
aacttagagcaagttccagtaatttctttaaatgcaagtggattagaaaagcatgaaggg
tttaaaatgtatccaggcttattaataaaatgtatatatgctctttattatggagatctg
cttatgtatatgtataatcagtgtaaatcttatgagattaataagggtgaaacagataag
gttttagataagtggattgagattttaaaagagaagtttgaaagcttaaaatatttaaag
gtaagagaactatataaaaatataattttagatttttctaagatagaattagaagaaact
gaaaaagtaaaggttggtatagtgggagaaatttatttaaagtattctcctttaggaaat
aataatttagaggaatttttaagagaagataatgctgaagttgttatgtctggtgttaca
gattttttcatgtattgtctatcaaattcagaaatagattataaattatatggaatgaaa
aaagtttcaagtaaattcactaaaattggatgttcatatttagagcatttacaaaatgtt
atgatagattcaataaaaaaatatagtaattttagagcacctgcgccatttaaggaatta
aaaacttctgttgaagagtacataggaagaggagttaaaatgggtgaaggatggcttatg
actgctgaaatgttagaacttataaatagtggtgtaaataatatagtttgtgctcaaccc
tttggatgtcttcctaatcacatagttggaaaaggtatgattagaggaattatggagaaa
catccagaagctaatatagttgttgtagattatgatccatcttcaacaaaggtaaatcaa
gaaaatagaataaaattaatgttagctaatgctaaattaagtgaatatatattaaataac
taa

DBGET integrated database retrieval system