KEGG   Clostridium perfringens 13: CPE1195Help
Entry
CPE1195           CDS       T00074                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2229 BcrAD_BadFG HGD-D FGGY_N ROK MutL
Motif
Other DBs
NCBI-ProteinID: BAB80901
UniProt: Q8XL47
Position
complement(1392606..1395620)
Genome map
AA seq 1004 aa AA seqDB search
MNYFFKIYSYFCMIINRNISIINKEVTLTLYYKIGIDAGSTTLKCIVLNEEDKILYSNYE
RHYSKVREKLIEELENIKGIIENKKFKIAITGSAGYGISKEYNLPFVQEVFATTLAIKRY
YDDVDVAIELGGEDAKIIFLTGGFEERMNSSCAGGTGAFIDQMAHLMGLTVDEMDNLSLK
HENIYEIASRCGVFAKTDIQPLLNQGARKEDISASVFQSVVNQTIGGLAQGRSIEGKIMF
LGGPLYFCKGLRERFIKTLKLKDNDVVSPENAQVFVAIGSAIYSKENNKKYEYEELLNII
KENHNEISTMNIIDPLFNSEGEYNEFKERHKKAKVKVSDINNYAGEAYVGIDAGSTTTKV
VLIDKEDNILYEYYGSNKGNPIEVVKKELKHIYNICGEKIKIMGSAVTGYGEELIKKAFS
IDFGIVETVAHYIAASHFNPKVDFILDIGGQDIKCFKIKDGIVANIMLNEACSSGCGSFI
ESFANQMGYDVETFSKLGLFAKHGADLGSRCTVFMNSSVKQAQKEGATVEDLSAGLSVSV
VKNALYKVIRAKSLDELGKNIIVQGGTMYNDAILRAFEKELGMNVIRPSISGLMGAYGCA
LYAKRKNLKESKIISKEDLESFTHKSKIAKCGLCTNRCNLTINIFNDGEKYISGNRCEKP
TGNKKSESIPNMYQYKYKKLREYESLDEGKRGTIGLPMVLNMYENIPLWATFFKELGFKV
VLSDESNKKMYLKGQHTIPSDTVCYPAKLAHGHIENLISKNIEHIFYPCMSYNFDEGISD
NCFNCPVVAYYPELLKTNVKELDSNNFMMEYLSLNNKKLLSKQLYEILNKTFGDIKQKEV
KNALEKAYIEYEKYTKHIKEKGEEFIEYAKNNNKKVIVVAGRPYHIDPEINHGIDKVLSS
LGIVVLTEDSIEVSHEKPKVNILNQWTYQARLYNAAYYVAKNKDMELIQLVSFGCGTDAI
TSDEVKDILERNNKIYTQLKIDETNNLGAAKIRIRSLLEAIAQE
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atgaattatttcttcaaaatttattcatatttttgcatgataattaatagaaatatatca
attattaataaagaggtgacattaactttgtattacaaaataggtattgatgcagggtct
acaaccttaaagtgtatagtcttaaatgaagaggacaagatactttactcaaattatgaa
agacattactctaaggtaagagaaaagctaatcgaagaactagaaaatataaaagggata
attgagaataaaaaatttaagatagctataactggatctgctggttatggaatttcaaaa
gagtataatttaccttttgttcaagaagtatttgctacaactttagctataaaaagatat
tatgatgatgtggatgtggcaatagagcttggaggagaagatgccaagataattttttta
actggtggttttgaggagagaatgaactcaagttgtgcagggggaacaggagcttttata
gatcaaatggctcaccttatggggcttactgtagatgaaatggacaacttaagtcttaaa
catgagaatatatatgagattgcttcaagatgtggggtttttgctaaaactgatatacaa
cccctattaaatcaaggagcaagaaaagaggatatttcagctagtgtattccaatctgtt
gtaaatcaaacaataggtggactagcacagggaagaagtattgaaggaaaaataatgttt
ttaggaggtcctttatatttctgtaagggattaagagagagattcataaaaacattaaaa
ttaaaggataatgatgttgtttctcctgaaaatgcacaagtttttgtggctattggaagt
gctatatattcaaaggaaaataataaaaaatatgaatatgaggaattattaaatataata
aaagaaaatcataatgaaatatcaaccatgaatataatagatccattatttaattctgaa
ggagaatataatgagtttaaggaaagacacaaaaaagctaaggttaaagttagtgatata
aataattatgctggagaggcatatgtaggcatagatgctggaagtactacaacaaaggtt
gttttaatagataaagaggataatattttatatgaatattatggatctaacaaaggaaat
cctattgaagttgtaaaaaaagaattaaagcatatttataatatatgtggagaaaaaatt
aagataatgggtagtgcagttactggctatggagaagagctaataaaaaaagccttttca
attgattttggaatagtagaaactgtagctcattatatcgcagcaagtcattttaatcct
aaggtagactttattttagatataggtggacaagatattaaatgctttaaaataaaggat
ggcattgtagccaatataatgctaaatgaagcatgttcatctggatgtggttcatttata
gaaagttttgctaatcaaatgggatatgatgtagaaactttttcaaagcttggtttattt
gcgaagcatggtgcagatttaggatcaagatgtacagtttttatgaactcatcagtaaaa
caagcacaaaaggaaggggctacagtagaagatctttcagctggactttccgtaagtgtt
gttaaaaatgctctttataaagtaataagagcaaaaagtcttgatgaattaggaaaaaat
ataattgttcaagggggaaccatgtataatgatgccatccttagagcttttgaaaaagag
cttggtatgaatgttataagacctagtatatcaggacttatgggagcttatggatgtgct
ctttatgcaaaaagaaaaaatttaaaggaaagtaagataatttctaaagaggatttagag
agttttacgcataaatcaaaaatagctaaatgtggattatgtactaatagatgtaattta
acaataaacatctttaatgatggagaaaaatatatttcaggaaatagatgtgaaaaacca
actggtaataaaaaatctgaaagtattcctaatatgtatcagtataaatataaaaaatta
agagaatatgaatcattagatgaaggaaaaagaggaactataggattaccaatggtatta
aatatgtatgaaaatattcctctatgggctacattctttaaagagttaggctttaaggtg
gttttatctgatgaatcaaataagaagatgtatttaaaagggcaacatacaattccatca
gatactgtgtgttatccagcaaaattagctcatggccatatagaaaacttaataagtaaa
aatatagagcatatattctatccatgtatgagttataattttgacgaaggtatatcagat
aattgttttaattgtcctgttgtagcttattatccagaacttttaaagacaaatgtaaaa
gagttagatagtaataactttatgatggaatatttaagcttaaacaataaaaaattatta
agcaaacaactttatgagattttaaataaaacttttggagatataaaacaaaaggaagtt
aaaaatgctttagaaaaggcttatatagagtatgagaaatatactaagcatataaaagaa
aaaggggaagagtttatagagtatgctaaaaataacaataagaaggttatagtagtagca
ggaagaccttatcacatagatccggaaataaatcatggaatagacaaggttttaagtagc
ttaggaattgttgttttaacagaagattctattgaagtaagtcatgaaaagccaaaggtt
aatatattaaatcaatggacatatcaagctagattatataatgctgcttattatgttgct
aaaaataaagatatggaacttatacaattagtttcctttggatgtggaacagatgccata
acttctgatgaagttaaagacatactagagagaaataacaaaatatatactcaattaaaa
atagatgaaactaataatttaggcgcagctaaaataaggataagaagcttgctagaggct
atagcacaggaatag

DBGET integrated database retrieval system