KEGG   Clostridium perfringens 13: CPE1216Help
Entry
CPE1216           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_29 AAA_21 AAA_23 SMC_N AAA_15 RsgA_GTPase DUF3948 AAA_22 AAA_27 NB-ARC AAA_25 ArgK AAA_30 Spore_IV_A Adeno_IVa2 AAA_33 AAA_24 AAA_16
Motif
Other DBs
NCBI-ProteinID: BAB80922
UniProt: Q8XL26
Position
complement(1420728..1420877)
Genome map
AA seq 49 aa AA seqDB search
MIRLENLEVSINKSEIIKGVSFHVNKGDFVGLIGPNGSGKSTILKTYIS
NT seq 150 nt NT seq  +upstreamnt  +downstreamnt
atgataagattagaaaatctagaagtttctataaacaaaagtgaaattataaagggagtt
tcatttcatgttaataagggtgattttgttggtcttatagggccaaatggaagcggaaaa
tcaaccatattaaaaacttatataagttaa

DBGET integrated database retrieval system