KEGG   Clostridium perfringens 13: CPE1217Help
Entry
CPE1217           CDS       T00074                                 

Definition
(GenBank) probable ABC transporter
  KO
K02015  iron complex transport system permease protein
Organism
cpe  Clostridium perfringens 13
Pathway
cpe02010  ABC transporters
Module
cpe_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CPE1217
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpe02000]
    CPE1217
Transporters [BR:cpe02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    CPE1217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD ABC-3
Motif
Other DBs
NCBI-ProteinID: BAB80923
UniProt: Q8XL25
Position
complement(1420883..1421941)
Genome map
AA seq 352 aa AA seqDB search
MFNLSWRKDKKVFIAVLLILLFISSIILGISFGAVDIPPYDVYRVFLYKVFGIKIGNLDE
ILNSTLFDIIWGVRMPRVLLGAFAGMALAMVGVIMQATIQNPLGDPYILGLSSGASLGAT
FSILIGFSGVLSSFGAPLGAFLGALIASIFVYFLAKIGGRITPFKMILAGMVISSICSSL
TSLIIFLSKDNEGIRTVNFWMMGSLAGAQWSNIVLPIAISVIPLIYFFTQYRNLNLMVLG
DETSITLGLNIEKHRKIYMILSSLITGVIVSVCGTIGFVGIMIPHIVRLIFGTDHKTLLP
FSALVGAIFLIWADVIARCAINNMELPIGIITSVIGAPFLLWLMVKGTREKE
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaatttaagttggagaaaagacaaaaaagttttcattgcagttttattaatttta
ctttttatatcatctataatattaggaatatcttttggagctgttgatattccaccttat
gatgtttacagagtatttttatataaggtttttggaattaagattggtaatttagatgaa
atattaaatagcactttatttgatataatatggggagtaagaatgccaagagtgctttta
ggagcttttgcaggtatggccttagctatggttggtgtaattatgcaagctactatacaa
aaccctttaggagatccttacatactaggattgtcatctggagcatctttaggtgctaca
ttttcaatactaataggattttcaggagtattatcaagctttggcgcacccttaggagca
tttttaggagctttaattgcatctatatttgtgtactttttagcgaaaataggtgggcgt
ataactccttttaagatgatattagctggtatggttataagttctatatgttcatcactt
acaagcttaataatatttttatcaaaggataatgaaggcataagaacagttaacttttgg
atgatgggaagtttggcaggagcacaatggagtaatatagttcttcccatagcaatatca
gttataccactaatatacttctttactcaatatagaaatttaaacttaatggtattagga
gatgaaacatctattaccttagggttaaatattgaaaagcatagaaaaatatatatgata
ctttcatctttaataactggagttattgtatcagtatgtggaactataggctttgttgga
attatgattccacacattgtaagacttatatttggaacggatcataaaactttactacct
tttagtgctttagttggagctatatttcttatatgggcagatgtaattgctagatgtgct
attaataatatggaacttcctataggaataattacctctgtaataggagcccctttctta
ttatggcttatggtaaaaggaactagagaaaaggagtaa

DBGET integrated database retrieval system