KEGG   Clostridium perfringens 13: CPE1223Help
Entry
CPE1223           CDS       T00074                                 

Definition
(GenBank) precorrin-2 methyltransferase
  KO
K03394  precorrin-2/cobalt-factor-2 C20-methyltransferase [EC:2.1.1.130 2.1.1.151]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00860  Porphyrin and chlorophyll metabolism
cpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CPE1223
Enzymes [BR:cpe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.130  precorrin-2 C20-methyltransferase
     CPE1223
    2.1.1.151  cobalt-factor II C20-methyltransferase
     CPE1223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase
Motif
Other DBs
NCBI-ProteinID: BAB80929
UniProt: Q8XL19
Position
complement(1426510..1427172)
Genome map
AA seq 220 aa AA seqDB search
MAILYGIGVGPGDSELLTIKAVKAIENSDVIVAPSAEEGGESIALIAAQEYIKEGTEIAV
KHFPMGKKNRELKVKEAYDFILEKLKEGKNVSFLTIGDPYVYSTYIHLLNYVEDHGFHVK
TIPGITSFCAAASIVDRTLVVGNEPLLVLPAGRVHDIKDEKFVVIMKVYKKEEEVLDVLE
EKGFDYVLVSRAGREGEKVLKTREEILNHRDYMSLILASK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcaatattatatggaataggtgtaggaccaggagatagtgaactattaacaataaag
gcagtaaaggctattgaaaatagtgatgttatagtagcaccaagtgcagaagaaggtgga
gagagcatagcattaatagcagctcaggaatacataaaagaaggaacagaaatagctgtt
aaacatttcccaatgggaaagaaaaacagagaattaaaagttaaagaggcttatgacttt
attttagaaaaacttaaagaaggaaaaaatgtaagtttcttaactataggggatccttat
gtttatagtacttatatacatttattaaattatgtagaagaccatggtttccatgtaaaa
actattccaggaataacatctttctgtgctgcagctagcatagttgatagaacattagtt
gtaggtaatgaaccattacttgttctgccagcaggtagagtacatgacataaaagatgaa
aagttcgttgtaataatgaaagtttataaaaaagaagaagaagttttagatgttttagaa
gaaaaaggatttgattatgttctagttagtagagcaggtagagaaggggaaaaagtttta
aaaactagagaagaaatcttaaatcatagagattacatgtctttaatactagcaagtaaa
tag

DBGET integrated database retrieval system