KEGG   Clostridium perfringens 13: CPE1225Help
Entry
CPE1225           CDS       T00074                                 

Definition
(GenBank) precorrin-6Y methylase
  KO
K03399  cobalt-precorrin-7 (C5)-methyltransferase [EC:2.1.1.289]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00860  Porphyrin and chlorophyll metabolism
cpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CPE1225
Enzymes [BR:cpe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.289  cobalt-precorrin-7 (C5)-methyltransferase
     CPE1225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase YrzO
Motif
Other DBs
NCBI-ProteinID: BAB80931
UniProt: Q8XL17
Position
complement(1427785..1428396)
Genome map
AA seq 203 aa AA seqDB search
MVKILGLGPGHEDYIIPKVIKELEKSDYIVGFERAISSLKFLNSINDERFKRVKGLKEII
EFLNENKEKRISIVASGDPTFYGITNYICKNYEGEVSIVPGISSFQYLTCRVNKTWNDAF
VGSMHGREENFIEVVKENKLSIWLTDKKNTPFELSKRLIENSIECTIYVGENLSYEDENI
TIGSPREICEKDYGDLSVIIIER
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttggttaaaatattaggattaggaccaggccatgaagactatataattcctaaagttatt
aaggaactagaaaaaagtgattatatagttggttttgaaagagcaatttctagcttaaag
tttttaaatagtataaatgatgaaagatttaagagagtaaaaggtttaaaagaaataata
gaatttctaaatgaaaataaggaaaagaggatttcaatagttgcctcaggagatccaacc
ttttatggaattacaaattatatatgtaaaaattatgagggagaagtttctattgttcct
ggaataagttcttttcaatatttaacatgcagagttaataaaacttggaatgatgctttt
gttggaagtatgcatggaagagaagagaattttatagaagttgtgaaggaaaataaactt
tctatttggttaacagataaaaaaaatactccttttgagctaagtaaaaggttaatagaa
aattctatagaatgtactatatatgttggagaaaatctttcttatgaagatgaaaatata
acaattggaagcccaagagaaatttgcgaaaaggattatggagatttatctgtaataata
attgaaagataa

DBGET integrated database retrieval system