KEGG   Clostridium perfringens 13: CPE1228Help
Entry
CPE1228           CDS       T00074                                 

Definition
(GenBank) CbiK protein
  KO
K02190  sirohydrochlorin cobaltochelatase [EC:4.99.1.3]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00860  Porphyrin and chlorophyll metabolism
cpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CPE1228
Enzymes [BR:cpe01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.3  sirohydrochlorin cobaltochelatase
     CPE1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiK CbiX
Motif
Other DBs
NCBI-ProteinID: BAB80934
UniProt: Q8XL14
Position
complement(1430168..1431010)
Genome map
AA seq 280 aa AA seqDB search
MKKAILVVSFGTSHLDALNNSIKKIEDSIQENFKEYDVFRSFTSHMIVRKLKEKHNMEVL
FPEDALKKLGEEGYEEVIVQPLHIIPGEEFDYIKHMVKEYEPCFKKIEIGRPIFHYEGFE
SGPDDYSYFVDTMKDLIEKNSPCVFVGHGSAHPSNAVYGCLQSVLIDKDYEDVFVGTVEG
YPNFSNVLKKAKKKDIKEITIIPLMVVAGDHAKNDMASDEEDSWKSRFESEGIKANVILK
GLGEYEEFGNLYIDRINDVINGTYKGLGETKKKKHRREMK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagctatattagtagtaagttttggaacaagtcatttagacgcgttaaataat
tctataaagaaaatagaagattcaatacaggaaaactttaaagaatatgatgtttttaga
agttttacatcacatatgatagtaagaaaacttaaagaaaaacataatatggaagtatta
tttccagaggatgctttaaagaaattaggagaggaaggatatgaggaagttatagttcaa
ccacttcatattattccaggagaagagtttgattatataaagcatatggtaaaggaatat
gaaccatgctttaaaaagatagaaataggaagaccaatattccattatgaaggttttgaa
tcaggtccagatgattattcatatttcgtagatacaatgaaagatttaatagaaaagaat
tctccatgtgtatttgttggacatggtagtgctcatccatcaaatgctgtttatggatgt
ttacaatctgttttaatagataaggactatgaagatgtttttgtaggaactgtagaaggg
tatcctaatttttcaaatgtcttaaagaaagctaagaagaaagatataaaagaaataaca
ataattcctttaatggttgtagctggagatcatgctaaaaatgatatggcttcagatgaa
gaagattcatggaagagcagatttgaaagtgaaggaataaaggctaatgttattttaaaa
ggcttaggagaatacgaagagtttggaaatttatacatagatagaattaatgatgttatt
aatggtacatataaaggacttggagaaactaaaaagaagaaacatagaagggaaatgaaa
taa

DBGET integrated database retrieval system