KEGG   Clostridium perfringens 13: CPE1231Help
Entry
CPE1231           CDS       T00074                                 

Definition
(GenBank) probable surface protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SH3_3 SH3_4 Glucosaminidase SH3_1 SH3_2 Sorb
Motif
Other DBs
NCBI-ProteinID: BAB80937
UniProt: Q8XL11
Structure
PDB: 

Position
complement(1433358..1436747)
Genome map
AA seq 1129 aa AA seqDB search
MNRNRLSCLIVGAVIGAGAIVCTTNTKVHAKPVNEVKNINTSKGNSFGEIISSEDIGLRK
GADSSHEIITSIPSGARVNIIDKMSKDWYKVSYKDFTGYLQAKDIRVLGDELNQDNVGLI
SANQLNVRTSPNENGQVIGTLHKNDKVNVLDKSIDGWYKIDFNGRRAYVSSKYVNLISYK
NNEVKTEVKKEPIEGTGKVNINTALNVRQASTTNSRIIGSLKGGEKVNIISESNGFYKIE
FNNSYGYVYSKYISKDGDSEKVQVVKQEEVKKEKVDESKKEAKATPKAEPVVLAVRSLNK
TGIVNVSSSLNVREGAGTSSKVIGSLSGNTKVTIVGEEGAFYKIEYKGSHGYVAKEYVKD
VTESSNSNQGTQTPEKPSTPESTEKTGIVNVSSSLNVREGASTSSKVIGSLSGNTKVIIV
GEEGAFYKIEYKGSHGYVAKEYIKDVTESNNSNQGTQTPEKPSTPESTEKTGIVNVSSSL
NVREGASTSSKVIGSLSGNTKVTIVGEEGAFYKIEYKGSHGYVAKEYIKDIKDEVVTEPE
KPSAPENTEKTGVVNVSSSLNVREGASTSSKVIGSLSGNTKVIIVGEEGAFYKIEYKGSH
GYVAKEYIKDVTESNNSNQGTQTPEKPSTPESTEKTGIVNVSSSLNVREGASTSSKVIGS
LSGNTKVTIVGEEGAFYKIEYKGSHGYVAKEYVKDVTESNNSNQGTQTPEKPSTPESAEK
TGVVNVSSSLNVREGASTSSKVIGSLSGNTKITIVGEEGAFYKIEYKGSHGYVAKEYIKD
IKDEVVTEPEKPSTHENSKKTGVVTASKGLNVRKEANTSSQIIGILNSGESVEIIGEENG
FYKITYKGQEAYASKNYINIFDGNSNVNPGLDIGNASKTNYGVSLNEYIKLQQRNNPSNY
SYSEFEKYINPAKATNKLQFLRIDKFRSVNVSGLSSRLSNKGVLTGQGQAFVNAAKAFNI
DPIYLVAQCLHETGNGTSKLAKGVTITEIADESKPIYNGNGQLVGYHMIKLSKPVTVYNL
FGIGAKDNSSVFPNRALILGTTYAYNRGWTSIENAIKGAAEFVSLNYVHSSRYSQNTLYK
MRYNQNVSNIWHQYATTPWYASSIADIMRSYQDLYLENNFTFDVPVFAG
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaaatagattaagctgtcttatagtaggtgctgtaattggagctggagcaata
gtttgtacaactaatactaaagtacatgcgaaaccagtgaatgaggttaaaaatattaat
acttctaaaggaaattcatttggagaaattatttcatcagaagacataggattaagaaaa
ggtgcagattcttctcatgaaataataacctcaatacctagtggtgctagggttaatata
atagacaaaatgtctaaggattggtataaggttagttataaagattttacaggatattta
caagctaaggacataagagtactaggagatgaattaaaccaagataatgttggtttaatt
tcagctaatcaattaaatgttagaactagcccaaatgaaaatggtcaagtgattggaact
ttacataaaaatgataaggtgaatgtattagataaatcaattgatggttggtataaaatt
gattttaatggtagaagagcatatgtatctagtaaatatgttaatttaatttcatataaa
aataatgaagttaagacagaagtaaaaaaagaaccaattgaaggaacaggtaaggttaat
ataaatacagctttaaatgttagacaagcgtctactacaaatagtagaattattggtagc
ttaaaaggtggagaaaaagttaacataataagtgaaagtaatggattttataaaatagag
tttaataattcatatggctatgtttattctaaatacatatcaaaagatggagatagtgaa
aaggttcaagttgtaaaacaagaagaagttaaaaaagaaaaagttgatgaatctaaaaaa
gaagctaaagctactcctaaagcagaacctgtggttttagccgttagatctcttaataag
acaggaatagtaaatgtaagtagttctctaaacgtaagagaaggagcaggtacaagtagt
aaagttataggaagcttaagcggaaacacaaaggtaacaatagtaggagaagaaggagca
ttctataaaatagaatataaagggtctcatgggtatgtagctaaggaatacgttaaagat
gttacagaaagtagtaatagcaaccaaggtacacaaacgccagaaaaaccaagtactcct
gaaagtactgaaaaaacaggaatagtaaatgtaagcagctcactaaacgtaagagaagga
gcaagtacaagtagtaaagttataggaagcttaagcggaaacacaaaggtaataatagta
ggagaagaaggagcattctacaaaatagaatataagggttctcatgggtatgtagctaag
gaatacattaaagatgttacagaaagtaataatagtaaccaaggtacacagactccagaa
aaaccaagtactcctgaaagtactgaaaaaacaggaatagtaaatgtaagtagttctcta
aacgtaagagaaggagcaagtacaagtagtaaagttataggaagcttaagcggaaacaca
aaggtaacaatagtaggagaagaaggagcattctataaaatagaatataaaggttctcat
ggatatgtagctaaggaatatatcaaggatattaaagacgaggtagtaacagaaccagaa
aaaccaagtgctcctgaaaatactgaaaaaacaggagtagtaaatgtaagcagttctcta
aacgtaagagaaggagcaagtacaagtagtaaagttataggaagcttaagcggaaacaca
aaggtaataatagtaggagaagaaggagcattctacaaaatagaatataagggttctcat
gggtatgtagctaaggaatacattaaagatgttacagaaagtaataatagtaaccaaggt
acacagactccagaaaaaccaagtactcctgaaagtactgaaaaaacaggaatagtaaat
gtaagtagttctctaaacgtaagagaaggagcaagtacaagtagtaaagttataggaagc
ttaagcggaaacacaaaggtaacaatagtaggagaagaaggagcattctataaaatagaa
tataagggttctcatgggtatgtagctaaggaatatgttaaagatgttacagaaagtaat
aatagtaaccaaggtacacaaacgccagaaaaaccaagtactcctgaaagtgctgaaaaa
acaggagtagtaaatgtaagcagttctctaaacgtaagagaaggagcaagtacaagtagt
aaggttataggaagcttaagcggaaacacaaagataacaatagtaggagaagaaggagcc
ttttataaaatagaatacaaaggttctcatgggtatgtagctaaggaatatattaaggat
attaaagacgaggtagtaacagaaccagaaaaaccaagtactcatgaaaatagtaagaaa
actggcgttgtaactgcatctaaaggattaaatgtaagaaaagaagctaatacttcatct
caaattattggaattttaaatagtggagaaagtgttgaaataataggagaagaaaatggt
ttctataagataacttataaaggacaagaagcttatgcatctaaaaattatataaatatt
tttgatggtaactcaaatgttaatcctggattagatataggaaatgcttcaaaaacaaat
tatggagtatcacttaacgaatatataaaattacaacaaagaaataatccttcaaattat
tcatactcagaatttgaaaaatatataaatccagctaaagctactaataagctacagttc
ttaagaatagataaattcagatcagttaatgtaagtggattaagtagtagattaagtaac
aaaggagttttaacaggacaaggacaagcttttgtaaatgctgctaaagcctttaacata
gatcctatatacttagttgctcaatgtttacacgaaacaggtaatggaacaagtaaactt
gcaaagggtgtaacaattactgaaattgcagatgaaagtaaacctatatataatggtaat
ggtcaattagtaggatatcatatgattaaattatctaagccagtaacagtttataattta
tttggaataggggctaaggataattcatcagtttttccaaatagagctttaatattagga
acaacatatgcttataatagaggttggacaagtattgaaaatgctataaagggtgctgca
gaatttgtttcattaaattatgttcatagttcaagatatagtcaaaatactctttataag
atgagatataatcaaaatgtatcaaatatatggcatcaatatgctacaacaccatggtat
gcatcaagtattgctgatattatgaggagttatcaagatttatatttagaaaataatttc
acatttgatgtacctgtttttgcaggataa

DBGET integrated database retrieval system