KEGG   Clostridium perfringens 13: CPE1233Help
Entry
CPE1233           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NifU_N
Motif
Other DBs
NCBI-ProteinID: BAB80939
UniProt: Q8XL09
Position
complement(1438156..1438854)
Genome map
AA seq 232 aa AA seqDB search
MNMMYSSEVQEMCVIAKGPNHGPAPIPVEGRWVQSREIKDVSGLTHGVGWCAPQQGACKL
TLNVKDGIIEEALIETIGCSGMTHSAAMASEILPGKTILEALNTDLVCDAINTAMRELFL
QIVYGRSQTAFSEGGLPIGAGLEDLGKGLRSQVGTMYGTLAKGPRYLEMAEGYVTKVALD
ADDQIIGYRFVHLGRMMEMVAKGMSANEAMEKATGQYGRFDEAVRTIDPRHE
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgatgtattcaagcgaagttcaagaaatgtgtgtaattgctaaaggtccaaac
cacggtccagcaccaatccctgtagaaggtagatgggttcaatcaagagaaataaaagat
gtttcaggtttaactcatggagttggctggtgtgcaccacaacaaggagcatgtaaatta
actttaaacgttaaagatggtatcatagaagaagctttaatagaaactataggatgttca
ggtatgactcactcagctgctatggcttcagaaatattaccaggaaaaactatattagag
gctttaaacacagacttagtttgtgatgctataaatactgcaatgagagaattattcctt
caaatagtttatggtagaagccaaactgctttctcagaaggtggactaccaataggagca
ggtcttgaggacttaggaaaaggattaagatcacaagtaggtactatgtacggaacttta
gctaaaggaccaagataccttgaaatggctgaaggatatgtaacaaaagtagctttagat
gcagatgatcaaatcataggatacagattcgttcacttaggtagaatgatggaaatggta
gctaaaggaatgagcgctaacgaagcaatggaaaaagctactggtcaatacggaagattt
gacgaagctgttagaactatagatccaagacacgaataa

DBGET integrated database retrieval system