KEGG   Clostridium perfringens 13: CPE1748Help
Entry
CPE1748           CDS       T00074                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00230  Purine metabolism
cpe01100  Metabolic pathways
Module
cpe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CPE1748
Enzymes [BR:cpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CPE1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 MMR_HSR1 AAA_22 ABC_tran CPT Thymidylate_kin Zeta_toxin AAA_17 Cytidylate_kin ADK RsgA_GTPase AAA AAA_29 AAA_16 Rad17 AAA_28 T2SSE ATPase_2 AAA_30
Motif
Other DBs
NCBI-ProteinID: BAB81454
UniProt: Q8XJK8
Position
complement(2025274..2025933)
Genome map
AA seq 219 aa AA seqDB search
MLKMMNKIHKDNRGVLIVISGPSGAGKGTICKALLEKHDDIFISISATTRNPRVGEVDGV
NYHFLTKEEFKQRIAEDDFLEHAEVYGNYYGTPKSSVEKMLDEGKNVILEIDIQGALKVK
EKATDGVFIFILPPSMEELKQRIIKRGSETPESLMTRFKSAYKEINYVSKYNYAVVNDNV
EDAVKKIEAILLAEKCRVDRLKENLLESKEDEMHEQLYD
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaagatgatgaataagatacataaggataatagaggtgtattaatagttatttct
ggtccttcaggtgcaggtaagggaactatttgtaaagccttattagaaaaacacgatgat
atatttatatcaatttctgctacaactagaaaccctagagtaggagaagttgatggagtt
aattatcatttcttaacaaaagaagaatttaaacaaagaatagcagaggatgatttcctt
gagcatgctgaagtatatggaaattattatggaactcctaaatcaagtgttgaaaaaatg
cttgatgaaggaaaaaacgtaatattagaaatagatatacaaggtgctttaaaagttaag
gaaaaggctactgatggagtatttatctttatattacctccttcaatggaagagcttaag
caaagaataataaaaagaggtagcgaaactccagaaagtttaatgactagatttaagtca
gcttataaagaaattaattatgtgtcaaaatacaattatgcagtagttaacgataatgta
gaagatgcagtaaagaaaatagaagctatattattagcagaaaaatgtagagtagataga
ttaaaagaaaacttattagagtcaaaggaggacgaaatgcatgaacaactctatgattaa

DBGET integrated database retrieval system