KEGG   Clostridium perfringens 13: CPE1823Help
Entry
CPE1823           CDS       T00074                                 

Definition
(GenBank) methylenetetrahydrofolate dehydrogenase (NADP+)/methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00670  One carbon pool by folate
cpe01100  Metabolic pathways
cpe01120  Microbial metabolism in diverse environments
cpe01200  Carbon metabolism
Module
cpe_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CPE1823
Enzymes [BR:cpe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     CPE1823
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     CPE1823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH
Motif
Other DBs
NCBI-ProteinID: BAB81529
UniProt: Q8XJD7
Position
complement(2101416..2102249)
Genome map
AA seq 277 aa AA seqDB search
MDKILSGKTVAIDIKGQIKSYTEELKASGKSLKISSILVGDDGGSVYYQNFQEKLANNLG
IDFEKIKLDESISEENLKLKIEELNKDDSVNGIMLLLPLPKHIDERAVTNLIDADKDLDC
LSEVSVGRFYKGEKCFMPCTPNSVITLLKAYNIEIEGKEVVIIGRSNIVGKPLFQMFLNE
NATVTVCHSRTKNLKEVCKRADILVVAIGRANFIDSSYVREGAVVIDVGTSEVNGKITGD
VNFDDVYDKASLITPVPGGVGSLTTTLLLKNVCKELD
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggataaaattttaagcggaaaaacagtggctatagacataaaggggcaaattaagagt
tatacagaggaattaaaagcttctggaaagtctttaaaaatatcgtctatactagttggg
gatgatggaggctcagtatattaccaaaacttccaagaaaaattagctaataatttagga
atagactttgagaagataaaactagatgaaagtatttcagaagaaaatctgaaacttaag
atagaagagttaaataaagatgacagtgtaaatggaataatgcttttattacctttacca
aagcatattgatgagagggcagttacaaatttaatagatgcagataaagacttagattgt
ctttctgaggtaagtgtaggtagattctataagggtgagaagtgttttatgccatgcaca
ccaaacagtgtaataactcttttaaaagcttataacattgaaattgagggtaaagaagtt
gttattattggaagaagtaatatagttggtaaacctctttttcaaatgtttttaaatgaa
aatgctacagtaacagtatgtcattcaagaactaagaacttaaaagaagtttgtaagaga
gctgacatattagtagtagctattggaagggctaatttcatagattcttcttatgttaga
gaaggagcggttgttattgatgtaggaactagtgaggttaatggtaaaataacgggagat
gttaattttgatgatgtttatgacaaagcatcattaattacaccagttccaggaggcgta
ggttctttaactacgactcttcttttaaaaaatgtttgtaaggagttagattag

DBGET integrated database retrieval system