KEGG   Chlamydia pecorum P787: CPE3_0689Help
Entry
CPE3_0689         CDS       T02853                                 

Gene name
bioF
Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
cpec  Chlamydia pecorum P787
Pathway
cpec00780  Biotin metabolism
cpec01100  Metabolic pathways
Module
cpec_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:cpec00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CPE3_0689 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpec01007]
    CPE3_0689 (bioF)
Enzymes [BR:cpec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     CPE3_0689 (bioF)
Amino acid related enzymes [BR:cpec01007]
 Aminotransferase (transaminase)
  Class II
   CPE3_0689 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AGW40017
Position
785028..786173
Genome map
AA seq 381 aa AA seqDB search
MSFQCFLKDSLEKRKENNTYRKLISLPNLKDFTSNDYLGFARSQELCTAILQKCASTSSL
GATGSRLLTGHSQYYEDLESSIAQTHHAENALIFNSGYTANLGLLSTIASPEDRFIHDLY
IHASMHDGIRLSKARSFPFRHNDIHHLQQRLETPHSGRTFVCVESVYSLHGSVAPLIEIQ
ELCERYEAQLIVDEAHALGIFGDHGEGLVTMLGLQDKVLATLYTFGKALGMHGAAIACST
TLKHYLINFCRPFIYTTALPSSSLISIDLAYQHNYDAVELRKHLSYLISFFRQQAEELGI
SLPKGNALSPIQSICIPRASRIRQVSQYLQESGFDVRPILSPTVRQNQELLRICIHTFNT
KEEISQVLLLISQALSCVSLL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtcattccagtgtttcctaaaagattctttagaaaaacgcaaagagaataacacctac
cgcaagctcataagtcttcctaaccttaaggacttcacctctaacgactacttgggattt
gcacgatctcaagagctttgcactgccattctccaaaagtgtgcatctacatcctcactg
ggagctacgggttctcgccttctcacaggacattcccaatactacgaagaccttgaaagt
tccattgcacaaacccatcatgctgaaaacgcccttattttcaattccggatacacggca
aatttaggtctcctctctaccatagcctcccctgaagatcgctttattcatgatctttat
attcatgcttctatgcatgatggtattcgtttaagcaaggcaagaagctttccctttagg
cataacgatattcaccatctgcaacaacgcctagaaactccccattcaggaagaaccttt
gtctgtgtagagtctgtgtattctcttcatggctctgttgctcccctcatagaaatccaa
gaactttgtgagcgctatgaagcacaattaattgtagatgaagctcatgctctaggaatc
tttggagatcatggtgaaggcctcgttactatgttagggttgcaagataaagtccttgcg
actctctataccttcggtaaggctctagggatgcacggggctgcgatagcatgtagcact
accttaaagcactacttaattaacttttgtcggccctttatctatacaacagcgttgcct
tcgagctcattaatctccatagaccttgcatatcagcataactatgatgctgttgagcta
cgtaagcatctttcctatctgatatcatttttccgacaacaagctgaagagttaggaatc
tccttacctaaaggaaatgcactctctccaatacaatctatttgcattcctagggcatcg
cgtatccgtcaggtttcccaatacctacaagagagcggctttgatgtcaggcccatattg
agtcctacagtaaggcaaaaccaagagctcttgcgaatctgcatccatacatttaatacc
aaagaggagatctctcaagtcctcctcttaatttcacaggcgttatcatgcgtatcgttg
ttgtag

DBGET integrated database retrieval system