KEGG   Corynebacterium pelargi: CPELA_07245Help
Entry
CPELA_07245       CDS       T05936                                 

Gene name
mca
Definition
(GenBank) Mycothiol S-conjugate amidase
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
cpeg  Corynebacterium pelargi
Brite
KEGG Orthology (KO) [BR:cpeg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CPELA_07245 (mca)
Enzymes [BR:cpeg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     CPELA_07245 (mca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: QAU52711
UniProt: A0A410W9S9
Position
complement(1580001..1580873)
Genome map
AA seq 290 aa AA seqDB search
MKPLRLLAIHAHPDDESSKGAATMAKYAAMGHEVMVLTCTGGERGDILNPAMNKPGVAEN
MSAIRREEMAEAIKAIGASHAWLGYVDSGLPEGDPPPPLPEGSFALADTDEVVAKVVAVI
RQFRPHVIITYDENGGYPHPDHLKVHEVSMLAWQRAGLGEYRPELGQPWEPLKLYYTHGF
IRQRMEMFHNLLIEQGKPSPYSDILERWKANKADVMARVTTQVYCAEFFEQRDDALRAHA
TQIDPAGTFFATPVEVQQRLWPTEEFELAATRVSTSIPEDDLFAGIDEQG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacttcgtttgctggcgatccatgcacatccagatgatgaatccagcaaaggt
gccgccacgatggcaaagtacgccgccatgggccacgaggtgatggtacttacctgtacc
ggtggtgaacgtggcgatattctcaaccccgccatgaataagcccggggttgcagaaaac
atgagcgctattcgacgcgaagaaatggccgaggcgatcaaagctattggcgcttcgcat
gcttggttggggtatgtcgattcgggattgcccgaaggggatccgccgccaccgcttccg
gaaggcagctttgccttggccgacactgatgaggttgtggcgaaggtcgtggcggtgatc
cgtcagttccgcccccatgtgatcatcacctatgacgaaaatggcggctaccctcaccct
gatcacctcaaggtgcatgaggtgtcgatgctggcttggcagcgagcagggcttggtgaa
tatcgcccagagctcgggcagccctgggagccactcaagctctattacacccacggcttt
atccgccagcgcatggagatgttccacaatctgctcattgagcagggcaagccaagcccc
tatagcgatattttggaacgctggaaagccaataaggccgatgtgatggccagggtgacc
acgcaggtctactgcgctgaattcttcgagcagcgcgacgatgccctgcgcgcccacgcc
acccaaatcgatcctgctggcaccttctttgccaccccagtagaagtgcaacagcgcctg
tggccaacagaggaattcgaattggccgctacccgggtcagcacctcgatcccggaggac
gatctttttgctggtattgatgagcaaggctaa

DBGET integrated database retrieval system