KEGG   Corynebacterium pelargi: CPELA_09510Help
Entry
CPELA_09510       CDS       T05936                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cpeg  Corynebacterium pelargi
Pathway
cpeg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cpeg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CPELA_09510 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cpeg03011]
    CPELA_09510 (rplV)
Ribosome [BR:cpeg03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CPELA_09510 (rplV)
  Bacteria
    CPELA_09510 (rplV)
  Archaea
    CPELA_09510 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: QAU53157
UniProt: A0A410WB27
Position
complement(2056590..2056949)
Genome map
AA seq 119 aa AA seqDB search
MSEAITSARATARFVRVSPMKARRVIDLVRGKSVEEALAILKYAPQAASEPVAKVVASAA
ANAENNFGLDRKSLVISEAFADEGPTMRRFQPRAQGRAFQIRKRTSHITVVVSQKEGAK
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagctatcacctccgcacgcgcaaccgcgcgcttcgtccgtgtttctccaatg
aaggcacgtcgcgtgatcgacctggttcgcggcaagtccgttgaagaagcactggctatc
ttgaagtacgcccctcaggctgcttcggagcccgttgccaaggtcgtcgcatccgctgcg
gctaacgccgagaacaacttcggcctggatcgcaagagcctggtcatctccgaggctttc
gccgacgagggtccgacgatgcgtcgattccagccgcgcgcacagggtcgtgcattccag
atccgtaagcgcaccagccacatcaccgtggttgttagccagaaggaaggggccaagtag

DBGET integrated database retrieval system