KEGG   Campylobacter peloridis: CPEL_1311Help
Entry
CPEL_1311         CDS       T03559                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
cpel  Campylobacter peloridis
Pathway
cpel00010  Glycolysis / Gluconeogenesis
cpel00020  Citrate cycle (TCA cycle)
cpel00620  Pyruvate metabolism
cpel01100  Metabolic pathways
cpel01110  Biosynthesis of secondary metabolites
cpel01120  Microbial metabolism in diverse environments
cpel01130  Biosynthesis of antibiotics
cpel01200  Carbon metabolism
Module
cpel_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cpel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPEL_1311 (pckA)
   00020 Citrate cycle (TCA cycle)
    CPEL_1311 (pckA)
   00620 Pyruvate metabolism
    CPEL_1311 (pckA)
Enzymes [BR:cpel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     CPEL_1311 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AJC85124
UniProt: A0A0A8GWV9
Position
complement(1350212..1351786)
Genome map
AA seq 524 aa AA seqDB search
MKDVEKLGLENIKKIYHNISYDELLKHEIENKEGICTKNGTFSVDTGIFTGRSPKDKYFV
KQDPSQKFVAWGKINQPISKELFEKLLTKAKKQLSNSDIYIQDAYCGASLKSRKAVRFVT
QIAWQAHFVKNMFIRPKEEELADFNPDFIVYNACKCVNEDYEKDGLNSEVFVIFNIEENI
AVIGGTWYGGEMKKGIFSMMNYWLPLENKLSMHCSANVGEKGDVALFFGLSGTGKTTLST
DPKRKLIGDDEHGWDDEGVFNFEGGCYAKCINLDPQSEPEIYGAIKQNALLENVVLKEDL
SVDFNDGSKTENTRVSYPIEHILNHEPSLSAGHPSNIIFLSADAFGVLPPVSKLSKEQAM
YYFLSGYTAKVAGTERGISEPVATFSACFGEVFLPLHPTIYAKLLGEKITKHDVNVYLVN
TGWSGGAYGVGKRMSIKATRACINAILDGSIKNCEFENYDLFNLAIPKELAGVEAKVLNP
INAWEDKKAYEETKLKLAKMFIENFKRYEDVKEGSEFKLAGPAI
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtagaaaaactaggcttagaaaatattaaaaagatttatcataatattagt
tatgatgaacttttaaagcatgaaattgaaaataaagaaggaatttgcacaaaaaatgga
acttttagcgtagatacgggaatttttactggtagaagtcctaaagataagtattttgta
aaacaagatccttcacaaaaatttgttgcttggggtaagattaatcaacctattagcaaa
gaattatttgaaaaacttttaacaaaagctaaaaaacaacttagcaatagtgatatttat
atacaagatgcttattgtggtgcttcgttaaaaagtcgtaaagcggtgcgttttgtaaca
caaattgcttggcaagcacactttgtaaaaaatatgtttattcgtcctaaagaagaagag
ttagcagattttaaccctgattttattgtttataatgcttgcaaatgtgtgaatgaagac
tatgaaaaagatggcttaaattctgaagtttttgtaatttttaacatagaagaaaatata
gcagtaattggtggaacttggtatggcggagagatgaaaaagggaattttttctatgatg
aattattggcttccactagaaaataaactttcaatgcattgtagtgctaatgttggagaa
aaaggcgatgttgcacttttctttgggcttagtggcacaggtaaaaccactctttcaact
gatccaaaaagaaaattaattggcgatgatgaacatggttgggatgatgagggtgtgttt
aattttgaagggggttgttatgcaaaatgtattaaccttgatcctcaaagtgaaccagaa
atttatggagctataaaacaaaatgcacttttagaaaatgtagttttaaaagaagattta
agtgttgattttaatgatggctcaaaaactgaaaatacaagagtatcctacccaatagaa
catattttaaaccatgaaccaagtcttagtgcaggtcatcctagcaatatcatctttctt
tcagcagatgcttttggggttttacctccagttagcaaacttagcaaagaacaagcgatg
tattattttttaagtggatatacagcaaaagttgcaggaacagaaagagggattagcgaa
cctgttgctactttttcagcttgttttggagaagtatttttaccgctacatccaactatt
tatgctaagcttttgggtgaaaaaatcactaagcatgatgttaatgtttatctagtaaat
accggctggagcggcggtgcttatggggttggtaaaagaatgagtataaaagctactaga
gcttgtattaatgctattttagatggtagtataaaaaattgtgaatttgaaaattatgat
ttatttaatcttgctattccaaaagaacttgctggtgttgaagctaaagtgctaaatcct
atcaatgcttgggaagataaaaaggcctatgaagaaactaaactaaagcttgctaaaatg
tttatagaaaattttaaacgctatgaagatgtaaaagaaggatcagaatttaaattagca
ggtcctgctatctaa

DBGET integrated database retrieval system