KEGG   Chlamydia pecorum PV3056/3: CPE1_0066Help
Entry
CPE1_0066         CDS       T02854                                 

Definition
(GenBank) putative phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cpeo  Chlamydia pecorum PV3056/3
Brite
KEGG Orthology (KO) [BR:cpeo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CPE1_0066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AGW37573
Position
73249..74523
Genome map
AA seq 424 aa AA seqDB search
MLFILIVFVFLSGCYTAWNIGANDVANAVGPSVGSGVLTLRQAVIIAAIFEFLGAVFFGD
RVVGTIENNLVSVSSLAPKDYIYGMTAALISTGVWLQIASLFGWPVSTTHSIVGAVVGFG
IVLGKGSIVHWDSVGTILIGWLLSPLIGGGGAYLVFSFIRRHIFYKNDPVQAMIRIAPFL
AALVIVTLGVIIVLGQVVAQTVSPWSLVGVAVLGACAYCITLYYVHTSHCVYISDSPKVG
GLTYRLKARGGDYGKKYLVVERIFAYLQIIITCFMAFAHGSNDVANAVAPVMGVLRHAYP
QLYTSRMLTLLMAGGGVWLVLGVAIWGWRVIETVGCKITELTPSRSFSVGMGATLTIAAS
SALGLPISTTHVVVGAVLGIGLARGTQAINLNIIKDIVTSWFITLPAGAILSMLFFFALR
ALFH
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgctattcatcctaatcgttttcgtatttctgagtgggtgttatactgcttggaatata
ggggctaatgatgtagcaaatgctgtagggccaagtgtaggatctggcgttctgactttg
cgacaggcagtaattatcgcggcaatttttgagtttttaggggcagtattcttcggggat
cgggttgttgggacaatagagaacaaccttgtttcggtttctagccttgcccctaaagat
tacatctatggcatgactgcagccctgatctctacaggcgtttggctgcagattgcctct
cttttcggctggcctgtatctactacgcactctattgttggtgctgttgtaggcttcggc
atagtattagggaaaggctctattgtacattgggattctgtagggactatcttgataggc
tggttactttctcccttaattggaggaggaggggcttatctggtcttttccttcattcgt
cggcatatcttctataagaatgatcctgttcaagcaatgattcgcatagcgccgtttttg
gcagcgcttgtaattgtcaccttaggggtcattattgtcttgggtcaggtcgtagcgcaa
actgtatctccatggtctttagtaggagtcgccgtcttaggagcgtgtgcatattgcatc
accttgtattacgtccatacgtcccattgtgtatatatttctgactctccaaaagtagga
ggattgacttaccgtttaaaggctcgagggggagattatgggaagaagtaccttgtcgta
gaaagaatctttgcgtatttgcaaattatcattacttgctttatggcctttgctcatggc
tctaatgatgtggctaatgccgtggctcctgttatgggagtgttgcgccatgcctatccc
caactctacacttcccgtatgttaactctcctgatggctggtgggggcgtgtggcttgtc
ctcggagtggcaatttggggctggagagtgattgagaccgtagggtgtaaaattactgag
ctgacaccttctcggagtttttctgtaggaatgggagcgaccttaaccattgcggcttct
tctgctctaggattgccgatatcgacaacgcatgttgttgtcggagcggttttaggaatc
ggcttagcacgaggaacacaagcgattaatttaaacattatcaaagacatcgtgacgtca
tggttcattacattacctgcaggtgcgattctttctatgctctttttctttgctttaaga
gcactatttcattaa

DBGET integrated database retrieval system