KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111776380Help
Entry
111776380         CDS       T05351                                 

Definition
(RefSeq) guanine nucleotide exchange factor SPIKE 1 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cpep04131]
    111776380
Membrane trafficking [BR:cpep04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    111776380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 TerB
Motif
Other DBs
NCBI-GeneID: 111776380
NCBI-ProteinID: XP_023511581
Position
LG15
AA seq 1831 aa AA seqDB search
MHLLHRRDSTPASIKWHNKFEENLEQWPHLNELVQCYSTDWVKDENKYGHYETIGPVSFQ
NQIYEGPDTDIETEMRLTYARRMKPDDTTEDDVPSTSGRPETTTHDPLSSNIPKQFDHSP
LPAYEPAFDWENERSMIFGQRIPEIPVTHGLKISVKVLSLSLQAGLCEPFYGTICLYNRE
RREKLSEDFHFRITPKEMQDPKISFEPRGIFYLEAPSASVCLFIQLEKHATEEGGVAASV
YSRKEPVHLSEREKQKLQVWSQIMPYRESFAWAIVALFDNSTGAASAGSASPSSPLAPNI
TGSSSHEGVFEPSTKVTVDGKLGCSSGSSVVVEISNLNKVKEGYTEDALQDPKYKVHKPV
KGVLRLEIEKHQISHADNENMSESGSVISDSVEMDSTFKKLPNNGSDSHHHSGSLKLNFS
DGKEFSGNGSYPHGNADSSADDFHAFDFRIMMRNEPFLQLFHCLYVYPMTVSLNRKRNLF
IRTELREDDSDPRRQPLEAMYPVELGASLQKWTHTQVAVAARVACYHDEIKLSLPATWTP
KHHLLFTFFNIDMQAKLEAPMPVPIGYASLPLSAHAQLRSEISLPVMRELVPHYLQDTNR
ERLDYLEDGKNIFKLRLRLCSSLYPINERIRDFFLEYDRHTLRTSPPWGSELLEAINSLK
NVDSTALLQFLHPILNMLLHLIGNGGETLQVAAFRAMVNIVTRVQQESAEDGERNHFLVN
YVDYAFDDFGGRQPPVYPGLSTVWGSLARSKAKGYRVGPVYDDVLAMAWFFLELIVKSMA
LEKTRLFYHSLPLGEDIPPMQLKEGVFRCIMQLYDCLLTEVHERCKKGLSLAKRLNSSLA
FFCYDLLSIIEPRQVFDLVSLYLDKFSGVCQSVLHDCKLTFLQIICDHDLFVEMPGRDPS
DRNYLSSVLIQELFLTWDHDDLPLRAKAARILVVLLCKHEFDARYQKPEDKLYIAQLYFP
LIGQILDEMPVFYNLNAIEKREVLIVILQIVRNLDDTSLVKAWQQSIARTRLFFKLMEEC
LILFEHRKPADGMLMGSSSRSPAAVGDTPGSPKYSDRLSPAINNYLSEASRQEFRPQGTP
DNGYLWQRVNSQLSSPNQPYSLREALAQAQSSRIGASAQALRESLHPVLRQKLELWEENL
SAAVSLQVLEITEKFSLMASSHSIATDYGKLDCITSIFMSFFSKNQPLAFYKALFPVFNS
VFDLHGATLMARENDRFLKQVTFHLLRLAVFRNDSIRKRAVSGLQILVRSSFCHFMQTAR
LRVMLIITLSELTSDVQVTQMKANGTLEESGEAQRLRKSLEDMADESKSSDLLKECGLPE
NALVIIPEASADNRWSWSELKYLSDSLLLALDASLEHALLASMMSMDRYAAAEGFYKLAM
AFAPVPDLHIMWLLHLCDAHQEMQSWAEAAQCAVAVAAMVMQALVARNDGVWSRDHVAAL
RRICPMVSGEITSEASAAEVEGYGASKLTVDSAVKYLQLANKLFSQAELYHFCASILELV
IPVYKSRRAYGQLAKSHTLLTNIYESILEQESSPIPFTDATYYRVGFYGESFGKLDRKEY
VYREPRDVRLGDIMEKLSHVYESRMDGSHTLHIIPDSRQVKAEELQPGACYLQITAVDPV
IEDEDLGSRRERIISLSTGSVRARVFDRFLFDTPFTKNGKTQGGLEDQWKRRTVLQTEGS
FPALVNRLLVTKSESLEFSPVENAIGMIETRTAALRNELEEPRSSEGDQLPRLQSLQRIL
QGSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAALLEFMAVCKRAIRVHFRLIGE
EDQEFHTQLVNGFQSLTAELSHYIPAILSEL
NT seq 5496 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcctacatcgccgagattccactcccgcgtctatcaaatggcacaacaagttt
gaggagaatttggagcaatggccacatctcaatgagctcgtgcagtgctattccactgac
tgggtaaaggatgaaaacaagtacggtcactatgagactattggtcccgtgtcctttcag
aatcagatatatgaaggccccgacactgacattgagactgaaatgcgtcttacttacgct
aggcgcatgaagcctgacgatactacagaggatgatgtacctagtacctctggacggcca
gagactacaacacatgatccattgtcatcaaatattccaaagcagtttgatcattctcct
cttccagcttatgagccagcttttgattgggaaaatgaaaggtcaatgatatttggccag
aggataccagaaattcctgtaacacatggcttgaagatttctgtgaaagttctatcctta
tcccttcaagcggggttgtgtgagccattttatggtacaatttgcttgtataatagggag
agaagagaaaaactatctgaggatttccattttcgcattactcctaaagaaatgcaggat
cctaaaatatcattcgaaccacgtggaattttctatttggaggctccatcagcatcagtc
tgtctttttattcagttagagaagcatgccacagaagaaggaggggttgccgcttctgtg
tattcacgtaaagaaccagtgcatttgagtgaaagagaaaagcaaaaactgcaagtgtgg
tctcaaatcatgccttacagagaatcctttgcctgggccattgttgcattatttgataac
agcactggtgcagcatctgctggatctgcttccccgagtagtcctcttgctcccaacata
actggatctagttcccatgagggtgtatttgagcctagcacaaaggtcacagtggatggt
aagctgggttgctctagtggaagctctgtagttgttgaaatatccaacttaaataaggtc
aaggaaggctacacggaagatgcacttcaggatcccaagtacaaggttcataaacctgta
aaaggtgttcttaggctggaaattgaaaagcaccagatttcccatgctgacaatgaaaac
atgtcagaaagtggtagtgtgatcagtgactctgttgagatggattccacatttaagaag
cttcctaataacggttctgatagccatcatcatagtggcagcttgaagttaaatttttct
gatgggaaagaattttctggtaatggatcatatccacatggaaatgcagattcaagtgca
gatgatttccacgcatttgacttccgcattatgatgaggaatgagccgttcttgcagctc
tttcactgtctttatgtttacccaatgactgttagtttgaaccgcaagaggaacttgttc
attcgtacagaacttagagaggatgatagtgacccgcgtagacagcctctagaggctatg
tatcctgtggagctgggtgcttctcttcagaagtggactcacactcaagttgctgtagct
gcaagagtagcttgctaccatgatgagattaaactctccctccctgctacctggacacca
aagcatcacttattattcactttcttcaacattgatatgcaagcaaaactagaagctcca
atgccagtgccaattggatatgcatcactccccttatcagcacatgctcagttacggtct
gaaatttctttaccagtaatgagagagcttgttccgcattacctccaagatacaaacagg
gagaggctagattacttggaagatggaaaaaacatctttaaattgcgtttaagactgtgt
tcctccctgtatcccattaatgaacgaatcagggatttttttctggaatatgatagacac
actcttcgaacaagccctccatggggttctgaacttcttgaggctattaacagtttgaag
aatgttgattccactgcgttgctccaattccttcatcctattttgaatatgttgcttcat
ctcattggcaatggtggagaaaccctccaggttgcggcgtttagagcaatggttaatatt
gttactagggtgcagcaggaatcggctgaagatggtgaaagaaaccacttcctggttaat
tatgtcgattatgcttttgatgacttcggaggtcgacagccacctgtgtaccctggtctg
tccactgtctggggaagcttggctaggagcaaggccaaaggctatcgtgttggaccagta
tatgatgatgttttggctatggcctggtttttccttgaactaattgtcaaatcaatggca
cttgagaaaactcggcttttctatcatagtcttccattaggtgaagatattcctccaatg
caattgaaagaaggtgtatttagatgtataatgcagttgtatgattgccttcttactgaa
gtacacgaacgttgcaagaagggattaagcttggctaaacgtttgaacagcagtttagcg
ttcttttgttatgatcttttgtccattattgaacctcgccaagtatttgatttggtttcc
ttgtacctggacaagttttcaggtgtctgccaatctgttctgcatgactgcaagcttaca
tttttacagattatatgtgatcatgacctctttgtggaaatgcccggaagagacccttct
gataggaactacctttcatcagtattaatacaagaactttttcttacttgggatcatgat
gatctacctctgcgggccaaggcggctagaattttagttgttctcttatgcaagcatgaa
tttgatgctcggtaccagaagcctgaagataaactatacattgctcagctgtattttcca
cttatcgggcagattttagatgaaatgcctgtcttctataacctaaatgccatagagaag
cgtgaagttttgattgtgattttgcaaattgtgcgcaatttagatgatacctcacttgtc
aaggcatggcaacaaagcattgctcgaaccagattatttttcaagctcatggaagaatgc
ctaattctttttgagcatagaaaacctgctgatggcatgcttatgggatccagttctcgg
agccctgctgctgttggtgatacccctggttcccctaagtactctgacagactatctcct
gcaatcaacaactacctatctgaggcatcaagacaagaattcagacctcagggaacacct
gataatggttatctgtggcagagggtgaattctcagttgagctccccaaatcagccatat
tcgttgagagaagcacttgcccaggcacaatcttctaggattggtgcatcggcccaggca
ctaagagagtcgctgcacccagtattaagacaaaaattagaactttgggaagaaaactta
agtgcagcagttagccttcaggttttggaaataacagagaagttttccttgatggcatct
tctcatagcattgccactgactacgggaaacttgattgcatcacctccatattcatgagc
ttcttctctaagaatcaacctttggcattctacaaggccttatttcccgtctttaacagt
gtctttgatcttcatggtgcaactttaatggcgagagaaaatgaccgtttcttgaagcaa
gtaacattccatcttcttcggcttgcagtttttcgaaatgatagcataaggaaaagagct
gtttcagggcttcagattcttgtgaggagttctttctgtcactttatgcagacggctaga
ttgagggtcatgctcataattactttatcagaattgacgtctgatgtgcaagtaactcag
atgaaggcaaatgggacacttgaagagagtggtgaagcacagcgtcttcgaaaatcctta
gaagacatggctgatgaatcgaagagttctgatctgctgaaggaatgcggacttcctgag
aatgctcttgtaataattccagaagcttctgctgacaataggtggtcctggtcagagttg
aaatatctttctgacagcctccttcttgctcttgatgctagtctagagcatgctctttta
gcctctatgatgtcaatggatagatatgctgctgcagaaggtttctataaacttgcaatg
gcattcgcccctgtgcctgatcttcatattatgtggttattgcatttatgcgatgcacat
caagagatgcaatcatgggcagaagctgcacagtgtgctgtagcggttgcagctatggtc
atgcaggctcttgttgctcgaaatgatggtgtctggagcagagatcatgtagcagctcta
cgtagaatatgccctatggtcagcggtgagatcacctcggaggcatcagcagctgaggtc
gagggatatggtgcttctaaacttactgtcgactctgctgtgaagtacctacagctcgca
aacaagcttttctcccaagctgagttgtatcatttttgtgctagtattctggaacttgta
attccagtctataaaagtaggagagcatatggacaactggcaaaaagtcacactttactg
acaaatatttacgaatcaatcctggagcaggagtcgagcccaattccgtttactgatgca
acttattatagggtgggattctatggtgaaagtttcgggaagctggacaggaaggaatac
gtttatcgtgagccccgtgatgtgcggttaggtgacataatggagaagctcagtcatgta
tatgaatctaggatggatggcagtcacacactgcatattattccagactccaggcaagtg
aaagcggaggagttgcagccgggagcttgctacctacagataacggcagttgaccctgtc
attgaagatgaagatctgggaagtagaagagagagaatcatttctctatccactgggagt
gtccgtgctcgtgtatttgaccgtttcttatttgatacaccatttaccaaaaatggaaag
actcaaggtggactagaagaccagtggaagaggaggactgttctacagaccgagggctcc
ttcccggcattggtaaatagactcttagtaaccaagtccgaatcgctcgagttctcccct
gtggaaaatgcaattggaatgattgaaactagaaccgctgctctgcggaatgaactggaa
gagcctcgcagttctgagggggatcaacttccacgactccagagtctccagagaatactc
caaggcagtgttgcagttcaagttaacagtggagtgttgagtgtgtgcactgcattcttg
tccggtgagccagctacgaggttgcggtcgcaggagttacagcaactcattgctgcgctt
cttgaatttatggctgtatgtaagcgtgcaattcgagttcatttcagattaattggagag
gaagaccaggagttccacacccaactggtgaatggatttcagtccctcaccgccgaacta
tcgcattatattcccgccattctatctgaattgtaa

DBGET integrated database retrieval system