KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111777428Help
Entry
111777428         CDS       T05351                                 

Definition
(RefSeq) probable serine/threonine-protein kinase At1g54610
  KO
K08819  cyclin-dependent kinase 12/13 [EC:2.7.11.22 2.7.11.23]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpep01001]
    111777428
Enzymes [BR:cpep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     111777428
    2.7.11.23  [RNA-polymerase]-subunit kinase
     111777428
Protein kinases [BR:cpep01001]
 Serine/threonine kinases: CMGC group
  CDK family
   111777428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 111777428
NCBI-ProteinID: XP_023512789
Position
LG16
AA seq 582 aa AA seqDB search
MGCICSKVLPDECSEHEHDSSNRTYSSRNHLSELKISRAGFPKSEKIWEKDRLDCSDVSV
MLFDTKANGPLRLHGELPNERKKKADVPDITIVTHPCMGKIPNATEAEQVAAGWPSWLAK
MAGEAIKGWLPKHANNFIKLEKIGQGTYSSVYKARDIIQDKVVALKRIRFDNQDAESIAF
MAREILVLRRLDHPNIVKLEGLITSQTSCHMYLVFEYMEHDLTGLASRPGTSFTEPQMKC
YMKQLLSGLAHCHSNGVLHRDIKGSNLLIDNNGVLKIADFGLAVFYDSQSMVPMTSRVIT
LWYRPPELLLGASQYGAEVDLWSAGCILGELYAGKPILPGKTEVEQLHKIFKLCGSPSKE
YWRNLHLKHSTSMKPPQSYERCLRERYNDIPHAAIELMDNLLTIDPAERGTAASALDSEF
FSTRPLPCNPSSLPKYPPSKEINSKLREEEARRQRGVGGGRSRAVDAELKGLKQSRVVPA
AKANSELVISLLRKQSFSISKYRSEKCSYGLVSKRTSSSGPIITQRPGFTNSKTVPKHVS
TIPRECLTSSGPIEFVSYKHVRERNGVSRPESMSQDKTLIVG
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgggttgcatctgttctaaggttttaccggatgagtgtagtgaacatgaacatgatagc
tccaatagaacatattcctccagaaaccacctctctgaattgaaaatatcaagagctggc
tttcccaaatcagagaagatttgggaaaaagatagactagattgtagcgatgtttcggtt
atgttgttcgatacgaaggcgaacggtcctctgcgcttgcacggtgagcttcctaatgag
aggaagaagaaggcagacgtccctgatatcaccattgtcactcatccatgtatgggaaag
attccgaacgctaccgaggctgagcaggttgctgctggttggccgagttggctggctaag
atggctggtgaggccatcaaagggtggctgcccaaacatgccaataacttcatcaagtta
gaaaagattggccagggaacctacagcagtgtgtataaagctcgtgatatcattcaggat
aaagttgtggccttgaaacggatcaggttcgacaatcaagacgccgagagtatcgcgttc
atggctagggaaatccttgttttgcgaaggcttgatcatccaaatatagttaagttggaa
ggtttgatcacatcacaaacatcatgtcacatgtaccttgtttttgaatatatggaacat
gatcttacaggacttgcatctcggcctggcacgtcgttcaccgagccacagatgaagtgt
tacatgaagcaacttttgagcggacttgctcactgtcacagtaatggggttctgcataga
gacataaagggctcaaatcttcttattgacaacaatggcgttttgaagatagcagatttt
gggttggctgttttctatgattcacagtcgatggttcccatgacgagtcgtgtaataacg
ctctggtatcgaccaccggaacttttacttggagcatctcaatatggagctgaagttgac
ttatggagtgctggttgcattctaggagagttatatgccggcaagcctatcttgccagga
aaaacagaggttgaacaactacacaaaatattcaagctatgtggttccccctccaaggaa
tattggagaaacttgcatttgaagcattcaacaagcatgaagcctccgcagtcgtacgaa
cgatgtcttcgagaaagatataacgacattcctcatgctgctattgagcttatggacaat
ttgctgactatagatcctgcagagcgaggaactgcagcttctgcgctcgacagcgagttc
tttagcacaaggcccttgccatgcaatccttcaagtttgccaaagtaccctcctagcaaa
gaaatcaattcaaaactgcgggaagaggaagcaagaaggcaacgaggagtaggtggcggg
agaagccgagcagtcgacgccgaactaaaaggactgaagcaatctcgggtagttcctgct
gcaaaggctaactctgagttggttatttcacttctgagaaaacaaagtttttcgatctcg
aagtaccggagcgaaaagtgttcttacggattggtgtcgaagagaacctcaagttcagga
cctataataactcagagaccaggatttacaaactcgaaaacggtaccgaaacacgtttca
acgattccgagggagtgtttaacatcatctgggccaattgagtttgtttcttacaaacat
gtccgagaaagaaatggagtttcaaggccagaatcaatgagccaagacaaaactctgata
gttggttga

DBGET integrated database retrieval system