KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111778736Help
Entry
111778736         CDS       T05351                                 

Definition
(RefSeq) MDIS1-interacting receptor like kinase 2-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpep01001]
    111778736
Enzymes [BR:cpep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111778736
Protein kinases [BR:cpep01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111778736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr ABC1
Motif
Other DBs
NCBI-GeneID: 111778736
NCBI-ProteinID: XP_023514477
Position
LG17
AA seq 483 aa AA seqDB search
MISGTIPRTFVDLLHGNYYTNYRILHKYGITLEIDFSHNFINGELPLSSLENHLRPTSID
FSYNSLIGKISDSFILFRNINLSYNKLEGKVSDQILHRFDVSVVLGNQNLCGSILPLHPC
DSQNHGIFKMLLILLPSIFLFLLGFVCLALVRSRKRKSVVHVINSNTHGNVFCIWDYDGK
IAYDDIIESTEDFDIKYCIGTGGYGSVYRARLPNGKVVALKKLHTREAQETTLFRSFRNE
VDMLKEIRHKNIIKLHGYCLHKRSMFLIYEYMERGSLFWVLSNDKEAVELDWKKRLNVIR
RVSHALSYIHHDWITSIIHRDVTTSNILLDSNLEAFLSDGISRLFDLESSYHTTVGGTCG
YIAPEKCDVYSFGVVALEVIMGKHPGELLTYLWSKSTPHIFINDLLDSRLKSPLLQIGVA
QSILLTLTLSFACLHPNPKSRPTMQHLTREFNIQRPYQDELVFNEITIEQLLRIQGNLKD
HAE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgattagtggcacaattcctaggacttttgtggatctacttcatggtaattattatact
aactatagaatattacataaatatggaattacgctcgagattgactttagtcataacttc
attaacggtgaactccccctttcgtcacttgagaatcatttaaggcctacgagtattgac
tttagctacaatagtcttattggcaaaatttcagattccttcattttatttagaaatatc
aatttatcatataacaagcttgaaggcaaggtttctgatcaaattctacatcgttttgat
gtaagtgttgtattgggtaatcaaaatctctgtggcagtattctcccgcttcacccctgt
gattcacaaaatcatggaattttcaaaatgttgttgattctgcttccttcaattttcttg
ttccttctcggtttcgtttgcttagctcttgttcgttcccgaaaaaggaaaagtgtcgtc
catgtgattaattcaaatacgcatggaaatgtgttctgcatatgggattatgatggcaag
attgcgtacgacgatattattgaatcaactgaagacttcgatattaaatattgcattggc
accggtgggtatggaagtgtttatagagcaaggcttccaaacggtaaggtcgtagctcta
aagaaactccacacccgtgaagcccaagagacaactcttttcagaagtttccgaaatgaa
gttgatatgttgaaagagataaggcacaagaacatcattaaactccatggatattgcctc
cataagcgttccatgtttctcatttatgaatacatggagaggggaagcctattttgggtg
ttgagtaacgacaaagaagcagtggaattggattggaagaaaagattgaacgtcatacga
agagtttcacatgctttgtcatacatacatcatgattggattacatcaatcattcatcgt
gatgttacaacgagtaatatacttttggactcaaatttagaagcttttctatctgatggt
atctcaagattatttgatcttgagtcctcttatcataccactgtcggtggcacttgtgga
tatatagctccagaaaaatgtgacgtctacagctttggagtggtggcattggaagtaata
atgggaaagcatcccggagaattattgacttacctgtggtctaaatctactccacatata
ttcatcaatgatttgttagactcacgactcaaatctcctctactacaaattggagtggca
caaagtatacttctcacattaacattgtcatttgcatgtctccatccaaatccaaaatct
cgacctacaatgcaacatttgactcgagaattcaatatccagaggccctatcaggatgaa
ctcgtatttaacgagattacaattgaacaacttttaagaatacaaggaaacttaaaggat
catgctgagtaa

DBGET integrated database retrieval system