KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111778754Help
Entry
111778754         CDS       T05351                                 

Definition
(RefSeq) uncharacterized protein LOC111778754
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH ABC1 Ssl1
Motif
Other DBs
NCBI-GeneID: 111778754
NCBI-ProteinID: XP_023514494
Position
LG17
AA seq 1171 aa AA seqDB search
MKTAEISSAIATLMGFRSLFLLLGICFAVRSCSVCESAVIAPNGRSQARSSLTGDIKSRI
IVPNGRNEVHSSLTATRLDDSSRAPSIALPPTVPAKKWGHGHEFRHSRRKFRNNAPRRGY
RASTPESGQQGRAAVSPIQSPLPSATRGRSPRPAPSPTIPPNHYYMPIPAPTISPMGSYK
KRKKSMPPSQVMMLPPPPPNGDCAISCTEPLTYTPPGTLCGCVWPIQVKISLDVAIYTFF
PLVSELAEEIADSIGLNHSQVRIMGADAASQQLEKTTVLINLVPRGPKFNDTMAFSIYQK
FWHRKISINASLFGRYQVLNVKYPGLPPSPPLPPSSTSSINDGLNTSNTNIGNAIKPLGV
DVPRRRKEGLSGNMIAVITISSFTAFVMCVGLAWLCLLRCRVFAHQAAQVPQNLIASPTK
PSGTAGVMMAVSEPGSSSLPLDADPMTYIGAAKNFTLKDMKKATDNFDVARILGEGGFGI
VYSGSLDDGREVAVKVLKRHNQHGIREFLAEVEMLSRLHHRNLVKLIGICTEDQIRCLVY
ELVPNGSVESHLHGIDKLTGPLDWDARMKIALGAARGLAYLHEDSNPRVIHRDFKASNIL
LEYDFTAKVSDFGLARTALEXCEVDCDTALAYAGLPPSPPLPPSSTSSINDGLNTSNTNI
GNAIKPLGVDVPRRRKEGLSGNMIAVITISSFTAFVMCVGLAWLCLLRCRVFAHQAAQVP
QNLIASPTKPSGTAGVMMAVSEPGSSSLPLDADPMTYIGAAKNFTLKDMKKATDNFDVAR
ILGEGGFGIVYSGSLDDGREVAVKVLKRHNQHGIREFLAEVEMLSRLHHRNLVKLIGICT
EDQIRCLVYELVPNGSVESHLHGIDKLTGPLDWDARMKIALGAARGLAYLHEDSNPRVIH
RDFKASNILLEYDFTAKVSDFGLARTALEEGNKHISTHVMGTFGYLAPEYAMTGHLLVKS
DVYSYGVVLLELLTGRKPVDLLLPPGQENLVAWARPLLTSKEGLDVITDPAIKSDISIDS
LARVAAIASMCVQPEVSHRPFMGEVVQALKLVCNEFEETNEAGSRSYSRDELLSYMDSKF
GGISGEILNATDTLHPFPSEKETNVGLSASDLISASARFEGQELVSLRWHTSNSEPLKMG
RKRQFWQKLRSLSRGSISEHGFSSKFWPGFR
NT seq 3516 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgctgaaatttcctctgcgattgcgactctgatggggtttcgatcgctgttt
ctgcttttggggatttgttttgctgttcgttcttgctctgtctgtgaatctgcagttatc
gccccgaacgggcgaagccaagcgcgttcttcgctcacaggtgacatcaaaagtagaatt
atcgtcccgaacggtcgaaacgaagtgcattcttcgctcacagcgactcgattagatgat
tcgagtagagctcctagcattgcacttccacctaccgtgcctgctaagaaatgggggcac
ggtcatgaatttcgccattcaagaaggaagttcagaaacaatgctccacggcgtggttat
cgtgcatcgactccggagagtggtcagcaaggccgtgctgctgtctctccaattcaatca
ccattaccatctgcaacgagaggaaggtcgccgagacctgcgccatcgccaacgattcca
ccgaaccactattatatgcccattcctgctcctacaatttctcctatgggttcttacaag
aagaggaagaagagcatgccaccatcacaagttatgatgctaccacccccacctcctaat
ggggattgtgcgatatcatgtaccgaaccactgacctatacacctcccgggacgttgtgt
ggttgcgtgtggccaattcaagtcaaaatcagtcttgatgttgcaatatacacgtttttc
cctttggtttcggagctggcagaggaaattgcagacagtattggtctgaaccatagccaa
gttcgaattatgggagctgatgctgctagtcagcagttggaaaaaacgaccgtcctcatc
aacttggttccgagaggaccgaaattcaatgataccatggccttttcgatatatcagaag
ttttggcatagaaaaatatccattaacgcttcgttatttggtcgatatcaagtcctgaat
gtcaaatatccaggtcttccgccgtctcctccgttacctccttcaagtacttcatccatt
aacgatggcttgaacacgagcaatactaatattggaaatgccataaaacctttgggagtt
gacgtgccaagaagaaggaaagaagggcttagcggaaacatgatcgccgtgattactata
tcgtcgttcactgcctttgttatgtgtgttggacttgcttggctttgcctgttgagatgc
agagtgtttgcacatcaggcagcacaagttccacaaaacttgatagcttcacctacaaaa
ccatcaggcactgctggagtaatgatggctgtaagtgaacctggttcttcatccctgcct
ctcgatgccgatcctatgacgtatataggagctgcaaagaacttcaccttgaaagatatg
aagaaagctaccgacaacttcgatgttgcaagaatattaggagaaggtggctttggaatt
gtttacagtggtagtttggatgatggaagggaagtggctgtgaaggttctcaaacgacat
aatcaacacggtattcgggaattcttggctgaagtcgagatgctgagccgtctacaccat
agaaatctagttaaattgattggtatctgtacagaagatcagattcgctgccttgtttat
gaattggttccgaatggaagcgtcgaatcgcatttacatggcattgacaagttaactggt
cctcttgactgggatgctcggatgaagattgccctcggtgctgctcgtggcctagcctat
ttgcacgaagactctaatcctcgagttattcatcgagatttcaaagctagcaacatcttg
ttggaatatgactttacagctaaagtttcagattttggattagctagaactgcactagag
gantgtgaagttgactgtgatacagctctagcttatgcaggtcttccgccgtctcctccg
ttacctccttcaagtacttcatccattaacgatggcttgaacacgagcaatactaatatt
ggaaatgccataaaacctttgggagttgacgtgccaagaagaaggaaagaagggcttagc
ggaaacatgatcgccgtgattactatatcgtcgttcactgcctttgttatgtgtgttgga
cttgcttggctttgcctgttgagatgcagagtgtttgcacatcaggcagcacaagttcca
caaaacttgatagcttcacctacaaaaccatcaggcactgctggagtaatgatggctgta
agtgaacctggttcttcatccctgcctctcgatgccgatcctatgacgtatataggagct
gcaaagaacttcaccttgaaagatatgaagaaagctaccgacaacttcgatgttgcaaga
atattaggagaaggtggctttggaattgtttacagtggtagtttggatgatggaagggaa
gtggctgtgaaggttctcaaacgacataatcaacacggtattcgggaattcttggctgaa
gtcgagatgctgagccgtctacaccatagaaatctagttaaattgattggtatctgtaca
gaagatcagattcgctgccttgtttatgaattggttccgaatggaagcgtcgaatcgcat
ttacatggcattgacaagttaactggtcctcttgactgggatgctcggatgaagattgcc
ctcggtgctgctcgtggcctagcctatttgcacgaagactctaatcctcgagttattcat
cgagatttcaaagctagcaacatcttgttggaatatgactttacagctaaagtttcagat
tttggattagctagaactgcactagaggaaggaaacaagcacatctcaacccatgtcatg
ggaacttttggttatctagctccggagtatgcaatgacgggccaccttcttgtaaagagc
gatgtctacagctatggtgttgttcttctcgagctacttacgggaagaaaaccagttgac
ttgttgcttccaccggggcaagaaaatcttgttgcttgggctcgaccgcttctaacgagc
aaggaggggttagatgtaattacagacccagctattaagtctgatatctctattgatagc
ttggccagagtagctgcaattgcttctatgtgtgtgcaacccgaagtgtctcacagacca
tttatgggcgaggttgttcaagctctaaagcttgtttgcaatgagttcgaagagacaaat
gaggcaggttcacgaagttacagccgagacgaacttctaagttacatggatagtaaattt
ggaggaatctcaggggaaatactaaacgctaccgacaccttgcacccgtttccttcagaa
aaagagacgaatgtaggactatcggcatcggatttgatcagcgcatctgcaagatttgaa
ggacaggaattagtttccttgagatggcatacatcaaactcagaacccttgaaaatggga
aggaagaggcagttctggcagaaactaagaagtttatcacgaggcagcatcagtgaacat
ggcttttcttctaaattttggcctggatttcgttag

DBGET integrated database retrieval system